GapMind for Amino acid biosynthesis

 

Aligments for a candidate for serA in Phaeobacter inhibens BS107

Align phosphoglycerate dehydrogenase; EC 1.1.1.95 (characterized)
to candidate GFF3560 PGA1_c36140 D-3-phosphoglycerate dehydrogenase SerA

Query= CharProtDB::CH_004924
         (525 letters)



>lcl|FitnessBrowser__Phaeo:GFF3560 PGA1_c36140 D-3-phosphoglycerate
           dehydrogenase SerA
          Length = 531

 Score =  403 bits (1036), Expect = e-117
 Identities = 210/501 (41%), Positives = 312/501 (62%), Gaps = 5/501 (0%)

Query: 3   RVLVSDKMSNDGLQPLIESDFIEIVQKNVADAEDELHT----FDALLVRSATKVTEDLFN 58
           +VL+SDK+S   +Q   +       Q ++   +D+L      +D L +RSATKVT+ + +
Sbjct: 4   KVLISDKLSEAAVQIFRDRGIDVDFQPDLGKDKDKLAAIIGDYDGLAIRSATKVTQKILD 63

Query: 59  KMTSLKIVGRAGVGVDNIDIDEATKHGVIVINAPNGNTISTAEHTFAMISSLMRHIPQAN 118
             T+LK++ RAG+G DNID D A++ GVIV+N P GN I+TAEH  AM+ ++ R IP+A+
Sbjct: 64  NATNLKVIARAGIGTDNIDKDAASQKGVIVMNTPFGNMITTAEHAIAMMFAVARQIPEAS 123

Query: 119 ISVKSREWNRTAYVGSELYGKTLGIVGLGRIGSEIAQRRGAFGMTVHVFDPFLTEERAKK 178
            S  + +W ++ ++G EL  KTLG++G G IG  +  R     M V  +DPFL++E+A K
Sbjct: 124 ASTHAGKWEKSKFMGVELTNKTLGVIGAGNIGGIVCDRARGLKMKVVAYDPFLSQEKADK 183

Query: 179 IGVNSRTFEEVLESADIITVHTPLTKETKGLLNKETIAKTKKGVRLINCARGGIIDEAAL 238
           IGV     +E+L  AD IT+H PLT +T+ +L+KE + KTKKGVR+INCARGG++DEAAL
Sbjct: 184 IGVEKVELDELLARADFITLHVPLTDQTRNILSKENLEKTKKGVRIINCARGGLVDEAAL 243

Query: 239 LEALENGHVAGAALDVFEVEPPVDNKLVDHPLVIATPHLGASTKEAQLNVAAQVSEEVLQ 298
            E L +GHVAGAA DVF  EP   N L   P V+ TPHLGA+T EAQ NVA QV+E++  
Sbjct: 244 AELLTSGHVAGAAFDVFSEEPAKTNPLFGLPNVVCTPHLGAATSEAQENVALQVAEQMSN 303

Query: 299 FAKGLPVMSAINLPAMTKDEFAKIKPYHQIAGKIGSLVSQCMKEPVQDVAIQYEGTIAKL 358
           +     V +A+N+P+MT +E   + P+  ++G +G  + Q   EP+Q + I Y+G  +++
Sbjct: 304 YLLDGAVENALNMPSMTAEEARVMGPWVALSGHLGGFIGQMTDEPIQAINILYDGVASEM 363

Query: 359 ETSFITKALLSGFLKPRVDSTVNEVNAGGVAKERGISFSEKISSSESGYDNCISVKVTGD 418
             + +  ++++G +K +++  VN V+A  VA+ERGI  S         +D  I V V   
Sbjct: 364 NLAALNCSVVAGIMK-KLNPDVNMVSAPVVARERGIQISTTNQDKSGTFDGYIKVTVVTS 422

Query: 419 RSTFTVTATYIPHFGERIVEINGFNIDFYPTGHLVYIQHQDTTGVIGRVGRILGDNDINI 478
           +   +V  T       R ++I G NID     H++Y  ++D  G+IG +G+ILGD  +NI
Sbjct: 423 KRERSVAGTVFSDGKPRFIQIKGINIDAEVGAHMLYTTNEDVPGIIGTLGQILGDMGVNI 482

Query: 479 ATMQVGRKEKGGEAIMMLSFD 499
           A   +GR E GGEAI +L  D
Sbjct: 483 ANFTLGRSEAGGEAIALLYVD 503


Lambda     K      H
   0.317    0.134    0.374 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 615
Number of extensions: 20
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 525
Length of database: 531
Length adjustment: 35
Effective length of query: 490
Effective length of database: 496
Effective search space:   243040
Effective search space used:   243040
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 52 (24.6 bits)

Align candidate GFF3560 PGA1_c36140 (D-3-phosphoglycerate dehydrogenase SerA)
to HMM TIGR01327 (serA: phosphoglycerate dehydrogenase (EC 1.1.1.95))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR01327.hmm
# target sequence database:        /tmp/gapView.10809.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01327  [M=525]
Accession:   TIGR01327
Description: PGDH: phosphoglycerate dehydrogenase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                          -----------
   1.5e-203  663.2   5.4   1.7e-203  663.0   5.4    1.0  1  lcl|FitnessBrowser__Phaeo:GFF3560  PGA1_c36140 D-3-phosphoglycerate


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Phaeo:GFF3560  PGA1_c36140 D-3-phosphoglycerate dehydrogenase SerA
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  663.0   5.4  1.7e-203  1.7e-203       1     521 [.       4     524 ..       4     528 .. 0.98

  Alignments for each domain:
  == domain 1  score: 663.0 bits;  conditional E-value: 1.7e-203
                          TIGR01327   1 kvlvadklseegiellkekelevdvktgl..skeellekikdydalivRSatkvteelleaaekLkvigRaGvGvD 74 
                                        kvl++dklse++++++++++++vd + +l  +k++l ++i dyd+l +RSatkvt+++l++a++Lkvi+RaG+G D
  lcl|FitnessBrowser__Phaeo:GFF3560   4 KVLISDKLSEAAVQIFRDRGIDVDFQPDLgkDKDKLAAIIGDYDGLAIRSATKVTQKILDNATNLKVIARAGIGTD 79 
                                        7*************************998335678999************************************** PP

                          TIGR01327  75 NidieaatkkGilvvNaPegntisaaElalalllalaRkipqadksvkekkWerkkflGtElygktlGviGlGriG 150
                                        Nid +aa++kG++v+N+P gn i++aE+a+a+++a+aR+ip+a +s++++kWe++kf+G+El++ktlGviG+G+iG
  lcl|FitnessBrowser__Phaeo:GFF3560  80 NIDKDAASQKGVIVMNTPFGNMITTAEHAIAMMFAVARQIPEASASTHAGKWEKSKFMGVELTNKTLGVIGAGNIG 155
                                        **************************************************************************** PP

                          TIGR01327 151 sevakrakalgmkvlayDPyiseekaeklgvellkdldellaeaDvitvHvPltketkgligkeelakmKkgviiv 226
                                         +v +ra++l+mkv+ayDP++s+eka+k+gve+++ ldella+aD+it+HvPlt++t+++++ke+l+k+Kkgv+i+
  lcl|FitnessBrowser__Phaeo:GFF3560 156 GIVCDRARGLKMKVVAYDPFLSQEKADKIGVEKVE-LDELLARADFITLHVPLTDQTRNILSKENLEKTKKGVRII 230
                                        ********************************666.**************************************** PP

                          TIGR01327 227 NcaRGGiidEkALvealeegkvraaalDvfekEPptdnklleldnvvvtpHlgAsteEaqenvavevaeevlealk 302
                                        NcaRGG++dE+AL+e+l++g+v++aa+Dvf++EP++ n+l+ l+nvv tpHlgA t+Eaqenva++vae+++++l 
  lcl|FitnessBrowser__Phaeo:GFF3560 231 NCARGGLVDEAALAELLTSGHVAGAAFDVFSEEPAKTNPLFGLPNVVCTPHLGAATSEAQENVALQVAEQMSNYLL 306
                                        **************************************************************************** PP

                          TIGR01327 303 gevvesavNlpaldaeeleklkpyldlaeklGklasqllkeavkkvevtleGelaeeeselltsallkgllkevle 378
                                        + +ve+a+N+p+++aee+  + p+++l+ +lG +++q+++e ++++++ + G  +e++  +l+ ++++g++k+ l+
  lcl|FitnessBrowser__Phaeo:GFF3560 307 DGAVENALNMPSMTAEEARVMGPWVALSGHLGGFIGQMTDEPIQAINILYDGVASEMNLAALNCSVVAGIMKK-LN 381
                                        **********************************************************************986.78 PP

                          TIGR01327 379 eevnlvnAkavakergitveeskeeesedyknllevkveadkgevsvagtvleekepriveidgfevdlepegill 454
                                         +vn+v+A++va+ergi+++ +++++s +++ +++v+v ++k e+svagtv+++ +pr ++i+g+++d e   ++l
  lcl|FitnessBrowser__Phaeo:GFF3560 382 PDVNMVSAPVVARERGIQISTTNQDKSGTFDGYIKVTVVTSKRERSVAGTVFSDGKPRFIQIKGINIDAEVGAHML 457
                                        8*************************************************************************** PP

                          TIGR01327 455 iiknkDkpGvigkvgsllgeagiNiasmqlgrkekggealmllslDeevseevleeikevpeiksvk 521
                                        +++n+D+pG+ig +g++lg++g+Nia+++lgr+e+ggea++ll +De+v++   ++++e +  +++k
  lcl|FitnessBrowser__Phaeo:GFF3560 458 YTTNEDVPGIIGTLGQILGDMGVNIANFTLGRSEAGGEAIALLYVDEPVPAAARAALAETEFFNQIK 524
                                        ****************************************************999999988777776 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (525 nodes)
Target sequences:                          1  (531 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.03u 0.01s 00:00:00.04 Elapsed: 00:00:00.03
# Mc/sec: 7.52
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory