GapMind for Amino acid biosynthesis

 

Alignments for a candidate for asp-kinase in Phaeobacter inhibens BS107

Align Aspartate kinase Ask_LysC; Aspartokinase; EC 2.7.2.4 (characterized)
to candidate GFF2319 PGA1_c23510 aspartokinase LysC

Query= SwissProt::A4VJB4
         (412 letters)



>FitnessBrowser__Phaeo:GFF2319
          Length = 412

 Score =  399 bits (1026), Expect = e-116
 Identities = 217/413 (52%), Positives = 292/413 (70%), Gaps = 7/413 (1%)

Query: 1   MALIVQKFGGTSVGTVERIEQVAEKVKKFRDGGDDIVVVVSAMSGETNRLIDLAKQISEQ 60
           M ++V KFGGTSV  ++RI + A++V      G +++V+VSAMSG+TN L+    + S  
Sbjct: 1   MPVLVMKFGGTSVANLDRIRRAAKRVGVEVAKGYNVIVIVSAMSGKTNELVGWVNETSPL 60

Query: 61  PVPRELDVMVSTGEQVTIALLAMALIKRGVPAVSYTGNQVRILTDSAHTKARILQIDAQR 120
              RE D +VS+GE VT  L+A+ L +  +PA S+ G QV + T SAH++ARI +I  + 
Sbjct: 61  FDAREYDAVVSSGENVTAGLMALTLQEMDIPARSWQGWQVPLKTTSAHSQARIEEIPPEN 120

Query: 121 IQRDIKAG-RVVVVAGFQGVDEKGNITTLGRGGSDTTGVALAAALKADECQIYTDVDGVY 179
           I      G RV VVAGFQG+  +G ITTLGRGGSDTT VA AAA +A+ C IYTDVDGVY
Sbjct: 121 INAKFGEGMRVAVVAGFQGISPEGRITTLGRGGSDTTAVAFAAAFEAERCDIYTDVDGVY 180

Query: 180 TTDPRVVAKAQRLDKITFEEMLEMASLGSKVLQIRAVEFAGKYSVPLRVLHSFQE---GP 236
           TTDPR+  KA++LDKI FEEMLE+ASLG+KVLQ R+VE A +Y V LRVL SF+E     
Sbjct: 181 TTDPRICDKARKLDKIAFEEMLELASLGAKVLQTRSVELAMRYKVKLRVLSSFEEQSDEA 240

Query: 237 GTLITLDEEESMEQPIISGIAFNRDEAKLTIRGVPDTPGVAFKILGPISAANVEVDMIVQ 296
           GTL+  DEEE ME  +++G+A++RDEAKLT++ V D PG+A  I   +S A V VDMIVQ
Sbjct: 241 GTLV-CDEEEIMESNVVAGVAYSRDEAKLTVQSVADRPGIAAHIFTALSEAGVNVDMIVQ 299

Query: 297 NVAHDNTTDFTFTVHRNDYNNALQVLQGI--AAEMGAREAIGDTNIAKVSIVGVGMRSHA 354
           +++ +  TD TF+   +    A Q LQ +    E+   E + D ++AKVS+VG+GMRS +
Sbjct: 300 DISDEGRTDMTFSCPTDQVVRAEQALQAVKEKGELNYAELLADRDVAKVSVVGIGMRSQS 359

Query: 355 GVASRMFEALAKENINIQMISTSEIKVSVVIEEKYLELAVRALHTAFELDAPA 407
           GVA++MF+ L+ E INI++I+TSEIK+SV+I+ KY+ELAV+ALH AFELD  A
Sbjct: 360 GVAAKMFKVLSDEGINIKVITTSEIKISVLIDRKYMELAVQALHDAFELDKAA 412


Lambda     K      H
   0.317    0.133    0.357 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 417
Number of extensions: 10
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 412
Length of database: 412
Length adjustment: 31
Effective length of query: 381
Effective length of database: 381
Effective search space:   145161
Effective search space used:   145161
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 50 (23.9 bits)

Align candidate GFF2319 PGA1_c23510 (aspartokinase LysC)
to HMM TIGR00656 (aspartate kinase, monofunctional class (EC 2.7.2.4))

Software error:

../bin/blast/fastacmd -i /tmp/list.29922.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.29922.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.