Align Anthranilate synthase component 1; AS; ASI; EC 4.1.3.27 (uncharacterized)
to candidate GFF2424 PGA1_c24550 putative para-aminobenzoate synthase component 1
Query= curated2:Q9Z4W7 (511 letters) >FitnessBrowser__Phaeo:GFF2424 Length = 383 Score = 184 bits (466), Expect = 6e-51 Identities = 103/286 (36%), Positives = 153/286 (53%), Gaps = 1/286 (0%) Query: 214 APAAFSGRPLAAATPADHGTQGWTANLTEAQFTERVARAREHIAAGDAFQIVLSRRLSRP 273 AP+ G D G +G T T ++ + A +I GD +Q L+ + Sbjct: 84 APSCGGGVASPDLPAGDVGLEGITPRWTYERYAQAFAEVNHNIGKGDIYQANLTFPIDAD 143 Query: 274 LRARPTDLYRHLRATNPSPYMYHLSLGGGRHVIGASPELLVKAEGR-TVRTRPLAGTRPR 332 +LY L A Y + G ++ SPEL + + + TRP+ GT+PR Sbjct: 144 AYGTAENLYAALEARQAVGYGALIEQDGLPDLLSRSPELFFRTDSDGVIETRPMKGTQPR 203 Query: 333 HPDPAEDLRLERELRADEKERAEHVMLVDLGRNDLGRVTEPGTVRVERLMRVERFSHVMH 392 DP ED R LR DEK RAE++M+VDL RND+ RV + G+V V L VE ++ V Sbjct: 204 SADPVEDARRRDFLRQDEKNRAENLMIVDLLRNDISRVAQTGSVHVPELFAVESYATVHQ 263 Query: 393 LSSTVRGRLAEGRDALDALRSAFPAGTLSGAPKIRAMEIIAELEPEQRGVYGGALGFVGA 452 + S VR RL + + FP G+++GAPKIR+MEI+A+LEP R +Y G +G+ Sbjct: 264 MVSMVRARLRPDAGLAEIFSALFPCGSITGAPKIRSMEILADLEPWARDIYCGTIGWAAP 323 Query: 453 DGLTDFAIALRTMVVADGHVHVQAGAGIVADSDPAAEFRETLHKSR 498 DG ++F +A+RT+++ DG + G G+V DS +E+ E L K+R Sbjct: 324 DGSSEFNVAIRTLMLEDGRATLNVGGGVVWDSTADSEYEEALWKAR 369 Lambda K H 0.319 0.134 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 447 Number of extensions: 22 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 511 Length of database: 383 Length adjustment: 32 Effective length of query: 479 Effective length of database: 351 Effective search space: 168129 Effective search space used: 168129 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory