GapMind for Amino acid biosynthesis

 

Aligments for a candidate for pre-dehydr in Phaeobacter inhibens BS107

Align Prephenate dehydrogenase (characterized, see rationale)
to candidate GFF655 PGA1_c06690 prephenate deydrogenase-like protein

Query= uniprot:A0A1L6J750
         (249 letters)



>lcl|FitnessBrowser__Phaeo:GFF655 PGA1_c06690 prephenate
           deydrogenase-like protein
          Length = 261

 Score =  172 bits (437), Expect = 5e-48
 Identities = 101/234 (43%), Positives = 134/234 (57%), Gaps = 1/234 (0%)

Query: 3   RFGIIGFGRFGQLAARHLRDHFSVVVTDTADVGEAAAAIGVKTGSLADAADCDVVMLAVP 62
           R G+IGFG FG+L ARHL     + V D     E      ++  SLA+ A C +V+LAVP
Sbjct: 9   RIGLIGFGAFGRLIARHLSPLLPICVYDPVQTDERPRHPSLRFDSLAETAACPLVILAVP 68

Query: 63  VQAMAATIAAIAPLVRPGALVLDVASVKMLPARWMLEALPESVDIVATHPLFGPQSARGG 122
           V AM      +APLVRPG  VLDV SVKM PA  M   LP  V+++ THPLFGP+S R G
Sbjct: 69  VGAMEPLCHTLAPLVRPGTWVLDVGSVKMAPADVMQRVLPPEVNLLGTHPLFGPESTRQG 128

Query: 123 LEGQPLVVCAVRGERHHKVAEFGRSL-GLSVSITTAEEHDREMAYVQALTHLIGRALVNI 181
           L GQ + +C +RG R  ++A   R +  L V  TT E HDRE+A VQ LTHLI +AL  +
Sbjct: 129 LAGQKIALCPLRGGRPLRLAAVLRHIFRLEVIWTTPEAHDRELATVQGLTHLIAQALNQV 188

Query: 182 RIPDEELKTNSYQHLLELCGLIRDDSKELFFAIQNLNPYAEEITRQFIAEANGL 235
                 + T S++ L +   ++  D+  +  AI   NP+A +I   F+  A  L
Sbjct: 189 APETLRMTTASFELLQQASRMVTGDAHGVLEAILRDNPFAADIRDSFLERAADL 242


Lambda     K      H
   0.321    0.135    0.387 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 164
Number of extensions: 8
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 249
Length of database: 261
Length adjustment: 24
Effective length of query: 225
Effective length of database: 237
Effective search space:    53325
Effective search space used:    53325
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 47 (22.7 bits)

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory