Align prephenate and/or arogenate dehydrogenase (EC 1.3.1.13) (characterized)
to candidate GFF655 PGA1_c06690 prephenate deydrogenase-like protein
Query= reanno::Korea:Ga0059261_2298 (249 letters) >FitnessBrowser__Phaeo:GFF655 Length = 261 Score = 172 bits (437), Expect = 5e-48 Identities = 101/234 (43%), Positives = 134/234 (57%), Gaps = 1/234 (0%) Query: 3 RFGIIGFGRFGQLAARHLRDHFSVVVTDTADVGEAAAAIGVKTGSLADAADCDVVMLAVP 62 R G+IGFG FG+L ARHL + V D E ++ SLA+ A C +V+LAVP Sbjct: 9 RIGLIGFGAFGRLIARHLSPLLPICVYDPVQTDERPRHPSLRFDSLAETAACPLVILAVP 68 Query: 63 VQAMAATIAAIAPLVRPGALVLDVASVKMLPARWMLEALPESVDIVATHPLFGPQSARGG 122 V AM +APLVRPG VLDV SVKM PA M LP V+++ THPLFGP+S R G Sbjct: 69 VGAMEPLCHTLAPLVRPGTWVLDVGSVKMAPADVMQRVLPPEVNLLGTHPLFGPESTRQG 128 Query: 123 LEGQPLVVCAVRGERHHKVAEFGRSL-GLSVSITTAEEHDREMAYVQALTHLIGRALVNI 181 L GQ + +C +RG R ++A R + L V TT E HDRE+A VQ LTHLI +AL + Sbjct: 129 LAGQKIALCPLRGGRPLRLAAVLRHIFRLEVIWTTPEAHDRELATVQGLTHLIAQALNQV 188 Query: 182 RIPDEELKTNSYQHLLELCGLIRDDSKELFFAIQNLNPYAEEITRQFIAEANGL 235 + T S++ L + ++ D+ + AI NP+A +I F+ A L Sbjct: 189 APETLRMTTASFELLQQASRMVTGDAHGVLEAILRDNPFAADIRDSFLERAADL 242 Lambda K H 0.321 0.135 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 164 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 249 Length of database: 261 Length adjustment: 24 Effective length of query: 225 Effective length of database: 237 Effective search space: 53325 Effective search space used: 53325 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory