Align acetohydroxyacid isomeroreductase (EC 1.1.1.86) (characterized)
to candidate GFF644 PGA1_c06580 ketol-acid reductoisomerase IlvC
Query= metacyc::MONOMER-18814 (338 letters) >FitnessBrowser__Phaeo:GFF644 Length = 340 Score = 460 bits (1183), Expect = e-134 Identities = 228/340 (67%), Positives = 268/340 (78%), Gaps = 2/340 (0%) Query: 1 MKVFYDKDADLSLIKGKNVTIIGYGSQGHAHALNLKDSGV-NVTVGLRKSGASWNKAANA 59 M+V+YD+D D++LIK K V I+GYGSQGHAHALNL+DSG N+ V LR+ AS KA Sbjct: 1 MRVYYDRDCDVNLIKDKKVAILGYGSQGHAHALNLRDSGAKNLVVALREGSASAKKAEGE 60 Query: 60 GLQVKEVAEAVKGADVVMILLPDEQIADVYKNEVHDNIKEGAALAFAHGFNVHYGAVIPR 119 GLQV +AEA DV+M +PDE A+ YK VHDNIK GAA+AFAHG NVH+G + P+ Sbjct: 61 GLQVMGIAEAAAWCDVIMFTMPDELQAETYKKYVHDNIKPGAAIAFAHGLNVHFGLIEPK 120 Query: 120 ADLDVIMIAPKAPGHTVRATYTQGGGVPHLIAVHQNKSGAARDIALSYATANGGGRAGII 179 +DVIM+APK PGHTVR YT+GGGVP L+AV + +G A +I LSY +A GGGR+GII Sbjct: 121 EGVDVIMMAPKGPGHTVRGEYTKGGGVPCLVAVDTDATGKALEIGLSYCSAIGGGRSGII 180 Query: 180 ETNFREETETDLFGEQAVLCGGTVELIKAGFETLVEAGYAPEMAYFECLHELKLIVDLIY 239 ETNFREE ETDLFGEQAVLCGG VELI+ GFETLVEAGYAPEMAYFECLHE KLIVDLIY Sbjct: 181 ETNFREECETDLFGEQAVLCGGIVELIRCGFETLVEAGYAPEMAYFECLHETKLIVDLIY 240 Query: 240 EGGIANMNYSISNNAEYGEYVTGPRVVT-EETKKAMKQCLTDIQTGEYAKSFLLENKAGA 298 EGGIANM+YSISN AEYG+YVTGPR++ E+TKKAMK LTDIQ G++ + F+LEN G Sbjct: 241 EGGIANMDYSISNTAEYGQYVTGPRILPYEQTKKAMKDVLTDIQQGKFVRDFMLENAVGQ 300 Query: 299 PTLISRRRLTAEHQIEEVGAKLRAMMPWIAKNKMVDQSKN 338 PT+ + RR EHQIE VG KLR MMPWI+ KMVD+ KN Sbjct: 301 PTIKASRRANDEHQIEVVGGKLRDMMPWISAGKMVDKEKN 340 Lambda K H 0.316 0.133 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 415 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 338 Length of database: 340 Length adjustment: 28 Effective length of query: 310 Effective length of database: 312 Effective search space: 96720 Effective search space used: 96720 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
Align candidate GFF644 PGA1_c06580 (ketol-acid reductoisomerase IlvC)
to HMM TIGR00465 (ilvC: ketol-acid reductoisomerase (EC 1.1.1.86))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00465.hmm # target sequence database: /tmp/gapView.29484.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00465 [M=314] Accession: TIGR00465 Description: ilvC: ketol-acid reductoisomerase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7e-127 408.7 0.3 8.1e-127 408.5 0.3 1.0 1 lcl|FitnessBrowser__Phaeo:GFF644 PGA1_c06580 ketol-acid reductois Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Phaeo:GFF644 PGA1_c06580 ketol-acid reductoisomerase IlvC # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 408.5 0.3 8.1e-127 8.1e-127 1 312 [. 14 328 .. 14 330 .. 0.98 Alignments for each domain: == domain 1 score: 408.5 bits; conditional E-value: 8.1e-127 TIGR00465 1 lkgkkvaiiGyGsqGeaqalnlrdsgl.nvivglrkeaaswkkAeedGfkvltveeaikkadlimiLlpDevqkevy 76 +k+kkvai+GyGsqG+a+alnlrdsg n++v+lr+++as kkAe +G++v+ ++ea++ d+im +pDe+q e+y lcl|FitnessBrowser__Phaeo:GFF644 14 IKDKKVAILGYGSQGHAHALNLRDSGAkNLVVALREGSASAKKAEGEGLQVMGIAEAAAWCDVIMFTMPDELQAETY 90 689***********************75799********************************************** PP TIGR00465 77 eaeikpllkegkallfsHGfnivfkqivipkdvdvvlvAPKgpGalvReeykegrGvpsliAveqdvtgeakeiAla 153 ++ +++++k g+a+ f+HG n++f i+++++vdv+++APKgpG++vR ey +g Gvp l+Av +d+tg+a ei l+ lcl|FitnessBrowser__Phaeo:GFF644 91 KKYVHDNIKPGAAIAFAHGLNVHFGLIEPKEGVDVIMMAPKGPGHTVRGEYTKGGGVPCLVAVDTDATGKALEIGLS 167 ***************************************************************************** PP TIGR00465 154 yAkaiGgaragvlettFkeEvesDLfGEqavLcGglealikaafdtLveaGyqpelAyfeivhelklivdllkekGl 230 y aiGg+r g++et F+eE+e+DLfGEqavLcGg+ +li+ +f+tLveaGy+pe+Ayfe++he klivdl++e+G+ lcl|FitnessBrowser__Phaeo:GFF644 168 YCSAIGGGRSGIIETNFREECETDLFGEQAVLCGGIVELIRCGFETLVEAGYAPEMAYFECLHETKLIVDLIYEGGI 244 ***************************************************************************** PP TIGR00465 231 elmrdavsntAklgalelr.eil.keelkkemqkilkeiqnGefakewalekeagkpafeearkkekeqeiekvGke 305 ++m ++sntA++g++ ++ +il e++kk+m+++l +iq+G+f ++++le+++g+p+ ++ r+++ e++ie vG + lcl|FitnessBrowser__Phaeo:GFF644 245 ANMDYSISNTAEYGQYVTGpRILpYEQTKKAMKDVLTDIQQGKFVRDFMLENAVGQPTIKASRRANDEHQIEVVGGK 321 *******************88874599************************************************** PP TIGR00465 306 lralvka 312 lr+++++ lcl|FitnessBrowser__Phaeo:GFF644 322 LRDMMPW 328 *****98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (314 nodes) Target sequences: 1 (340 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.81 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory