GapMind for Amino acid biosynthesis

 

Aligments for a candidate for ilvC in Phaeobacter inhibens BS107

Align acetohydroxyacid isomeroreductase (EC 1.1.1.86) (characterized)
to candidate GFF644 PGA1_c06580 ketol-acid reductoisomerase IlvC

Query= metacyc::MONOMER-18814
         (338 letters)



>lcl|FitnessBrowser__Phaeo:GFF644 PGA1_c06580 ketol-acid
           reductoisomerase IlvC
          Length = 340

 Score =  460 bits (1183), Expect = e-134
 Identities = 228/340 (67%), Positives = 268/340 (78%), Gaps = 2/340 (0%)

Query: 1   MKVFYDKDADLSLIKGKNVTIIGYGSQGHAHALNLKDSGV-NVTVGLRKSGASWNKAANA 59
           M+V+YD+D D++LIK K V I+GYGSQGHAHALNL+DSG  N+ V LR+  AS  KA   
Sbjct: 1   MRVYYDRDCDVNLIKDKKVAILGYGSQGHAHALNLRDSGAKNLVVALREGSASAKKAEGE 60

Query: 60  GLQVKEVAEAVKGADVVMILLPDEQIADVYKNEVHDNIKEGAALAFAHGFNVHYGAVIPR 119
           GLQV  +AEA    DV+M  +PDE  A+ YK  VHDNIK GAA+AFAHG NVH+G + P+
Sbjct: 61  GLQVMGIAEAAAWCDVIMFTMPDELQAETYKKYVHDNIKPGAAIAFAHGLNVHFGLIEPK 120

Query: 120 ADLDVIMIAPKAPGHTVRATYTQGGGVPHLIAVHQNKSGAARDIALSYATANGGGRAGII 179
             +DVIM+APK PGHTVR  YT+GGGVP L+AV  + +G A +I LSY +A GGGR+GII
Sbjct: 121 EGVDVIMMAPKGPGHTVRGEYTKGGGVPCLVAVDTDATGKALEIGLSYCSAIGGGRSGII 180

Query: 180 ETNFREETETDLFGEQAVLCGGTVELIKAGFETLVEAGYAPEMAYFECLHELKLIVDLIY 239
           ETNFREE ETDLFGEQAVLCGG VELI+ GFETLVEAGYAPEMAYFECLHE KLIVDLIY
Sbjct: 181 ETNFREECETDLFGEQAVLCGGIVELIRCGFETLVEAGYAPEMAYFECLHETKLIVDLIY 240

Query: 240 EGGIANMNYSISNNAEYGEYVTGPRVVT-EETKKAMKQCLTDIQTGEYAKSFLLENKAGA 298
           EGGIANM+YSISN AEYG+YVTGPR++  E+TKKAMK  LTDIQ G++ + F+LEN  G 
Sbjct: 241 EGGIANMDYSISNTAEYGQYVTGPRILPYEQTKKAMKDVLTDIQQGKFVRDFMLENAVGQ 300

Query: 299 PTLISRRRLTAEHQIEEVGAKLRAMMPWIAKNKMVDQSKN 338
           PT+ + RR   EHQIE VG KLR MMPWI+  KMVD+ KN
Sbjct: 301 PTIKASRRANDEHQIEVVGGKLRDMMPWISAGKMVDKEKN 340


Lambda     K      H
   0.316    0.133    0.379 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 415
Number of extensions: 15
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 338
Length of database: 340
Length adjustment: 28
Effective length of query: 310
Effective length of database: 312
Effective search space:    96720
Effective search space used:    96720
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 49 (23.5 bits)

Align candidate GFF644 PGA1_c06580 (ketol-acid reductoisomerase IlvC)
to HMM TIGR00465 (ilvC: ketol-acid reductoisomerase (EC 1.1.1.86))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR00465.hmm
# target sequence database:        /tmp/gapView.16627.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00465  [M=314]
Accession:   TIGR00465
Description: ilvC: ketol-acid reductoisomerase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                         Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                         -----------
     7e-127  408.7   0.3   8.1e-127  408.5   0.3    1.0  1  lcl|FitnessBrowser__Phaeo:GFF644  PGA1_c06580 ketol-acid reductois


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Phaeo:GFF644  PGA1_c06580 ketol-acid reductoisomerase IlvC
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  408.5   0.3  8.1e-127  8.1e-127       1     312 [.      14     328 ..      14     330 .. 0.98

  Alignments for each domain:
  == domain 1  score: 408.5 bits;  conditional E-value: 8.1e-127
                         TIGR00465   1 lkgkkvaiiGyGsqGeaqalnlrdsgl.nvivglrkeaaswkkAeedGfkvltveeaikkadlimiLlpDevqkevy 76 
                                       +k+kkvai+GyGsqG+a+alnlrdsg  n++v+lr+++as kkAe +G++v+ ++ea++  d+im  +pDe+q e+y
  lcl|FitnessBrowser__Phaeo:GFF644  14 IKDKKVAILGYGSQGHAHALNLRDSGAkNLVVALREGSASAKKAEGEGLQVMGIAEAAAWCDVIMFTMPDELQAETY 90 
                                       689***********************75799********************************************** PP

                         TIGR00465  77 eaeikpllkegkallfsHGfnivfkqivipkdvdvvlvAPKgpGalvReeykegrGvpsliAveqdvtgeakeiAla 153
                                       ++ +++++k g+a+ f+HG n++f  i+++++vdv+++APKgpG++vR ey +g Gvp l+Av +d+tg+a ei l+
  lcl|FitnessBrowser__Phaeo:GFF644  91 KKYVHDNIKPGAAIAFAHGLNVHFGLIEPKEGVDVIMMAPKGPGHTVRGEYTKGGGVPCLVAVDTDATGKALEIGLS 167
                                       ***************************************************************************** PP

                         TIGR00465 154 yAkaiGgaragvlettFkeEvesDLfGEqavLcGglealikaafdtLveaGyqpelAyfeivhelklivdllkekGl 230
                                       y  aiGg+r g++et F+eE+e+DLfGEqavLcGg+ +li+ +f+tLveaGy+pe+Ayfe++he klivdl++e+G+
  lcl|FitnessBrowser__Phaeo:GFF644 168 YCSAIGGGRSGIIETNFREECETDLFGEQAVLCGGIVELIRCGFETLVEAGYAPEMAYFECLHETKLIVDLIYEGGI 244
                                       ***************************************************************************** PP

                         TIGR00465 231 elmrdavsntAklgalelr.eil.keelkkemqkilkeiqnGefakewalekeagkpafeearkkekeqeiekvGke 305
                                       ++m  ++sntA++g++ ++ +il  e++kk+m+++l +iq+G+f ++++le+++g+p+ ++ r+++ e++ie vG +
  lcl|FitnessBrowser__Phaeo:GFF644 245 ANMDYSISNTAEYGQYVTGpRILpYEQTKKAMKDVLTDIQQGKFVRDFMLENAVGQPTIKASRRANDEHQIEVVGGK 321
                                       *******************88874599************************************************** PP

                         TIGR00465 306 lralvka 312
                                       lr+++++
  lcl|FitnessBrowser__Phaeo:GFF644 322 LRDMMPW 328
                                       *****98 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (314 nodes)
Target sequences:                          1  (340 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 7.71
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory