Align 3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54) (characterized)
to candidate PP_2324 PP_2324 tyr-sensitive phospho-2-dehydro-3-deoxyheptonate aldolase
Query= BRENDA::P00888 (356 letters) >FitnessBrowser__Putida:PP_2324 Length = 370 Score = 417 bits (1072), Expect = e-121 Identities = 205/350 (58%), Positives = 261/350 (74%), Gaps = 1/350 (0%) Query: 6 LNNVHITDEQVLMTPEQLKAAFPLSLQQEAQIADSRKSISDIIAGRDPRLLVVCGPCSIH 65 ++++++ + L+TP+QLK PLS + + R+ + +I+ G+D RL VV GPCSIH Sbjct: 18 IDDLNVASNETLITPDQLKKEIPLSAKALQTVTAGREVVRNILDGKDHRLFVVVGPCSIH 77 Query: 66 DPETALEYARRFKALAAEVSDSLYLVMRVYFEKPRTTVGWKGLINDPHMDGSFDVEAGLQ 125 D + A EYA R K LA EVSD+LYLVMRVYFEKPRTTVGWKGLINDP++D SF ++ GL Sbjct: 78 DIKAAHEYAERLKVLAEEVSDTLYLVMRVYFEKPRTTVGWKGLINDPYLDDSFKIQDGLH 137 Query: 126 IARKLLLELVNMGLPLATEALDPNSPQYLGDLFSWSAIGARTTESQTHREMASGLSMPVG 185 I RKLLL+L MGLP ATEALDP SPQYL DL SWSAIGARTTESQTHREMASGLS VG Sbjct: 138 IGRKLLLDLAEMGLPTATEALDPISPQYLQDLISWSAIGARTTESQTHREMASGLSSAVG 197 Query: 186 FKNGTDGSLATAINAMRAAAQPHRFVGINQAGQVALLQTQGNPDGHVILRGGKA-PNYSP 244 FKNGTDG L AINA+++ ++PHRF+GINQ G V+++ T+GNP GHV+LRGG PNY Sbjct: 198 FKNGTDGGLTVAINALQSVSKPHRFLGINQEGGVSIVTTKGNPYGHVVLRGGNGKPNYDS 257 Query: 245 ADVAQCEKEMEQAGLRPSLMVDCSHGNSNKDYRRQPAVAESVVAQIKDGNRSIIGLMIES 304 VA CE+++ +A ++ ++MVDCSH NSNKD QP V E+V QI +GN+SIIGLM+ES Sbjct: 258 VSVALCEQDLAKAKIKANIMVDCSHANSNKDPALQPLVMENVANQILEGNQSIIGLMVES 317 Query: 305 NIHEGNQSSEQPRSEMKYGVSVTDACISWEMTDALLREIHQDLNGQLTAR 354 +++ G QS + +++YGVS+TDACI W T+ LR +H L L R Sbjct: 318 HLNWGCQSIPKNLDDLQYGVSITDACIDWSATEKTLRSMHAKLKDVLPQR 367 Lambda K H 0.316 0.131 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 404 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 356 Length of database: 370 Length adjustment: 29 Effective length of query: 327 Effective length of database: 341 Effective search space: 111507 Effective search space used: 111507 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
Align candidate PP_2324 PP_2324 (tyr-sensitive phospho-2-dehydro-3-deoxyheptonate aldolase)
to HMM TIGR00034 (3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00034.hmm # target sequence database: /tmp/gapView.17634.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00034 [M=342] Accession: TIGR00034 Description: aroFGH: 3-deoxy-7-phosphoheptulonate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-155 503.1 0.0 1.7e-155 502.9 0.0 1.0 1 lcl|FitnessBrowser__Putida:PP_2324 PP_2324 tyr-sensitive phospho-2- Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Putida:PP_2324 PP_2324 tyr-sensitive phospho-2-dehydro-3-deoxyheptonate aldolase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 502.9 0.0 1.7e-155 1.7e-155 1 339 [. 19 361 .. 19 364 .. 0.98 Alignments for each domain: == domain 1 score: 502.9 bits; conditional E-value: 1.7e-155 TIGR00034 1 ddlrivkidelltPeelkakfpltekaaekvaksrkeiadilaGkddrllvviGPcsihdpeaaleyakrlkkla 75 ddl++++ + l+tP++lk+++pl++ka ++v+ r+ + +il+Gkd+rl+vv+GPcsihd +aa eya+rlk la lcl|FitnessBrowser__Putida:PP_2324 19 DDLNVASNETLITPDQLKKEIPLSAKALQTVTAGREVVRNILDGKDHRLFVVVGPCSIHDIKAAHEYAERLKVLA 93 78999999******************************************************************* PP TIGR00034 76 eklkddleivmrvyfekPrttvGWkGlindPdlnesfdvnkGlriarkllldlvelglplatelldtispqylad 150 e+++d l++vmrvyfekPrttvGWkGlindP+l++sf++++Gl+i rkllldl+e+glp+ate+ld+ispqyl d lcl|FitnessBrowser__Putida:PP_2324 94 EEVSDTLYLVMRVYFEKPRTTVGWKGLINDPYLDDSFKIQDGLHIGRKLLLDLAEMGLPTATEALDPISPQYLQD 168 *************************************************************************** PP TIGR00034 151 llswgaiGarttesqvhrelasglslpvgfkngtdGslkvaidairaaaaehlflsvtkaGqvaivetkGnedgh 225 l+sw+aiGarttesq+hre+asgls +vgfkngtdG+l vai+a+++ +++h+fl+++++G v+iv+tkGn++gh lcl|FitnessBrowser__Putida:PP_2324 169 LISWSAIGARTTESQTHREMASGLSSAVGFKNGTDGGLTVAINALQSVSKPHRFLGINQEGGVSIVTTKGNPYGH 243 *************************************************************************** PP TIGR00034 226 iilrGGkk.pnydaedvaevkeelekaglkeelmidfshgnsnkdykrqlevaesvveqiaeGekaiiGvmiesn 299 ++lrGG+ pnyd+ +va ++++l ka+ k+++m+d+sh+nsnkd q+ v+e+v++qi eG+++iiG+m+es+ lcl|FitnessBrowser__Putida:PP_2324 244 VVLRGGNGkPNYDSVSVALCEQDLAKAKIKANIMVDCSHANSNKDPALQPLVMENVANQILEGNQSIIGLMVESH 318 ******988****************************************************************** PP TIGR00034 300 leeGnqsl...keelkyGksvtdacigwedteallrklaeavk 339 l+ G qs+ ++l+yG+s+tdaci+w te+ lr +++++k lcl|FitnessBrowser__Putida:PP_2324 319 LNWGCQSIpknLDDLQYGVSITDACIDWSATEKTLRSMHAKLK 361 ********63335789**********************99876 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (342 nodes) Target sequences: 1 (370 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 10.39 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory