GapMind for Amino acid biosynthesis

 

Alignments for a candidate for cysE in Pseudomonas putida KT2440

Align Serine acetyltransferase; SAT; EC 2.3.1.30 (uncharacterized)
to candidate PP_3136 PP_3136 putative O-acetyltransferase

Query= curated2:P71405
         (171 letters)



>FitnessBrowser__Putida:PP_3136
          Length = 174

 Score = 89.7 bits (221), Expect = 2e-23
 Identities = 55/128 (42%), Positives = 71/128 (55%), Gaps = 1/128 (0%)

Query: 37  YRLAHALHKRRFYFIARALSQLARFITGIEIHPGAKIGRGLFIDHGMGVVIGETTEIGDD 96
           Y L  AL ++    I + L +  + ITGIE+     IGR   IDH  G+V+      GDD
Sbjct: 34  YTLRPALLRKLCSLIYKVLFKFVQIITGIELPCEVVIGRNFVIDHFGGIVVSGYARFGDD 93

Query: 97  VTIYHGVTLGGTGKFKGKRHPTLGNRVVVGAGAKVLGAICVGDDVKIGANAVVLSDLPTG 156
             I +GV +G          P  GN V +G GAKVLG+I +G++V IGANAVVL D+P  
Sbjct: 94  CRIRNGVVVG-LKNVDEPIAPVFGNNVDIGTGAKVLGSIRIGNNVIIGANAVVLVDVPDN 152

Query: 157 STAVGSKA 164
           S AVG  A
Sbjct: 153 SLAVGVPA 160


Lambda     K      H
   0.323    0.142    0.422 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 93
Number of extensions: 5
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 171
Length of database: 174
Length adjustment: 18
Effective length of query: 153
Effective length of database: 156
Effective search space:    23868
Effective search space used:    23868
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 44 (21.6 bits)

This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory