Align Histidinol-phosphatase [alternative form] (EC 3.1.3.15) (characterized)
to candidate PP_0261 PP_0261 adenosine-3'(2'),5'-bisphosphate nucleotidase
Query= reanno::Korea:Ga0059261_2035 (260 letters) >FitnessBrowser__Putida:PP_0261 Length = 266 Score = 82.0 bits (201), Expect = 1e-20 Identities = 74/235 (31%), Positives = 106/235 (45%), Gaps = 22/235 (9%) Query: 13 RLADAAGAAIRPYFRAEHGLESKDDSSPVTLADKAAEAAMRRLIIAERPMDAIIGEEE-- 70 +LA AG AI P++RA+ + +K D SPVT AD AA + ++A P ++ EE+ Sbjct: 6 KLALTAGEAILPFWRADVAVTNKADDSPVTAADLAAHRVIADGLLALAPQIPVLSEEDCN 65 Query: 71 ---DDRPGTSGRIWVLDPIDGTRSFIVGRPIFGTLIALLEDGWPVLGIIDQPIIKERWLG 127 +R S R W++DP+DGT+ FI G F IAL+E+G V G++ P + G Sbjct: 66 IALAERQNWS-RWWLVDPLDGTKEFIAGSEEFTVNIALIENGEVVFGVVSMPTNGRCYFG 124 Query: 128 VTGRETLFNGKPARARTCRELSKALLATTSPALFT--DGQLHAFEHVDA--AVMSTVLG- 182 G A A +L + A FT + H+ +A A + +G Sbjct: 125 GRG----MGAWRADAGEAAQLIQVRNAPAQGERFTVVASRRHSSPEQEALLAGLGAAVGE 180 Query: 183 ------GDCYNYGLVASGHLDIVIE-AGLKLHDFAALVPVVEGAGGRMCDWQGDP 230 G + L+A G D A D AA VVEGAGG + G P Sbjct: 181 LELANIGSSLKFCLLAEGSADCYPRLAPTSQWDTAAAQGVVEGAGGEVIGLDGLP 235 Lambda K H 0.320 0.138 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 197 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 266 Length adjustment: 25 Effective length of query: 235 Effective length of database: 241 Effective search space: 56635 Effective search space used: 56635 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory