Align branched-chain-amino-acid transaminase (EC 2.6.1.42) (characterized)
to candidate PP_5275 PP_5275 putative regulator
Query= BRENDA::A0A060PQX5 (417 letters) >FitnessBrowser__Putida:PP_5275 Length = 496 Score = 195 bits (495), Expect = 3e-54 Identities = 118/379 (31%), Positives = 193/379 (50%), Gaps = 8/379 (2%) Query: 33 EVRELLKLVESSDVISLAGGLPAPETFPVEIIAEITKEVLEKHAAQALQYGTTKGFTPLR 92 +V EL++ DV+ L G+P ++ ++ + ++ + L Y G LR Sbjct: 113 QVLELVRSTPRQDVVQLGRGMPDIDSPTLKPLLRSLAQLSRRQDMPGLYYDNIHGNLALR 172 Query: 93 LALAEWMRKRYDIPISKVDIMITSGSQQALDLIGRVFINPGDIVVVEAPTYLAALQAFKY 152 +A M + D++IT+G +AL R PGDIV V++P++ A+Q K Sbjct: 173 EQVARLMLDS-GCRLGPADLVITTGCHEALSCSIRAVCEPGDIVAVDSPSFHGAMQTLKG 231 Query: 153 YEPEFVQIPLDD-EGMRVDLLEEKLQELEKEGKKVKLVYTIPTFQNPAGVTMSEKRRKRL 211 + ++IP D G+ ++ LE L++ +KL+ P+ NP G M E R+K L Sbjct: 232 LGMKALEIPTDPVTGISLEALELALEQWP-----IKLIQITPSCNNPLGYIMPEARKKAL 286 Query: 212 LELASEYDFLIVEDNPYGELRYSGEPVKPIKAWDDEGRVMYLGTFSKILAPGFRIGWIAA 271 L LA YD I+ED+ YG+L Y+ + +K++DD+GRV+ +FSK LAPG RIGW+A Sbjct: 287 LSLAQRYDVAILEDDVYGDLAYTYPRPRTLKSFDDDGRVLLCSSFSKTLAPGLRIGWVAP 346 Query: 272 EPHLIRKLEIAKQSVDLCTNPFSQVIAWKYVEGGHLDNHIPNIIEFYKPRRDAMLKALEE 331 +L R L + S + IA ++ GH H+ + Y+ RD M + Sbjct: 347 GRYLERVLHMKYISTGSTASQPQLAIA-DFIAAGHYQPHVRRMRSQYQRGRDLMGDWVTR 405 Query: 332 FMPEGVRWTKPEGGMFVWVTLPEGIDTKLMLEKAVAKGVAYVPGEAFFAHRDVKNTMRLN 391 + P G R ++P+GG +WV LPE +DT + + +GV G F A ++ +R+N Sbjct: 406 YFPAGTRVSRPQGGFMLWVELPEHLDTLRLNRALLEQGVQVAVGSIFSASGKFRHCLRMN 465 Query: 392 FTYVPEEKIREGIKRLAET 410 F P +I ++++ ET Sbjct: 466 FAARPTPQIEASVRKVGET 484 Lambda K H 0.318 0.137 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 483 Number of extensions: 24 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 417 Length of database: 496 Length adjustment: 33 Effective length of query: 384 Effective length of database: 463 Effective search space: 177792 Effective search space used: 177792 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory