GapMind for Amino acid biosynthesis

 

Alignments for a candidate for leuD in Pseudomonas putida KT2440

Align 3-isopropylmalate dehydratase small subunit; EC 4.2.1.33; Alpha-IPM isomerase; IPMI; Isopropylmalate isomerase (uncharacterized)
to candidate PP_2112 PP_2112 aconitate hydratase 1

Query= curated2:Q5JFV7
         (163 letters)



>FitnessBrowser__Putida:PP_2112
          Length = 913

 Score = 44.7 bits (104), Expect = 4e-09
 Identities = 27/69 (39%), Positives = 40/69 (57%), Gaps = 2/69 (2%)

Query: 35  RIAFIEARPEFSREVKPGDVVVGGRNFGIGSSRESAALSLKAAGVAGVIAESFGRIFYRN 94
           +++  +A   + +E  P  +V+ G+ +G GSSR+ AA      GV  V+AESF RI   N
Sbjct: 766 KLSIYDAAMRYQQEGTPL-LVIAGQEYGTGSSRDWAAKGTNLLGVKAVLAESFERIHRSN 824

Query: 95  AVNLG-LPL 102
            V +G LPL
Sbjct: 825 LVGMGVLPL 833


Lambda     K      H
   0.321    0.142    0.421 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 372
Number of extensions: 18
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 1
Length of query: 163
Length of database: 913
Length adjustment: 30
Effective length of query: 133
Effective length of database: 883
Effective search space:   117439
Effective search space used:   117439
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory