Align dihydrodipicolinate synthase subunit (EC 4.3.3.7) (characterized)
to candidate PP_2036 PP_2036 putative 4-hydroxy-tetrahydrodipicolinate synthase
Query= metacyc::MONOMER-6565 (289 letters) >FitnessBrowser__Putida:PP_2036 Length = 295 Score = 149 bits (375), Expect = 1e-40 Identities = 85/280 (30%), Positives = 146/280 (52%), Gaps = 1/280 (0%) Query: 11 VTPFDKNENIDFQKLSKLIDYLLNNGTDSLVVAGTTGESPTLSEEEKVALIQYSVKEAAG 70 +TPF + +D L ID L+ G ++ G+TGE LS+ E ++++S AG Sbjct: 14 ITPFTADGTLDLDALGTSIDSLIAGGVHAIAPLGSTGEGAYLSDSEWETVVRFSQARIAG 73 Query: 71 RAPIIAGTGSNNTKASIKLTKKAEEAGADAVMLVTPYYNKPSQEGMYRHFRAIAEETSLP 130 R P + T +++ + A+ GA AVM++ Y K ++ + H++A+ +P Sbjct: 74 RVPSVVSVSDLTTARTVQRARLAQACGATAVMVLPISYWKLTEAEVVAHYKAVGAAIDIP 133 Query: 131 VMLYNVPGRTAASLAPETTIR-LAEIPNIIAIKEASGDLDAITKIVAETPEDFAVYSGDD 189 +MLYN PG + L+ E +R L E+PN+ +KE++GD+ + ++ T A Y+G + Sbjct: 134 IMLYNNPGTSGTDLSVELILRILGEVPNVTMVKESTGDIQRMHRLFTATDGQVAFYNGCN 193 Query: 190 SLTLPALSVGARGIVSVASHIIGPEMQEMIKHYTEGNTAQAALIHQKLLPLMKGLFAAPN 249 LTL AL GA G + A ++I + +G+ A+A + + L++ + Sbjct: 194 PLTLEALVAGATGWCTAAPNLIPALNLALWDAVQQGDLAEARALFYRQYELLEYITRRGL 253 Query: 250 PSPLKTALQLKGLDVGSVRLPLIPLNEDERLRLSSLMNGL 289 P+ +K L++ G DVG+ RLPL PL+ L SL+ L Sbjct: 254 PTTIKAGLKMLGQDVGAPRLPLQPLDAQGSNHLKSLLVAL 293 Lambda K H 0.313 0.131 0.357 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 247 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 289 Length of database: 295 Length adjustment: 26 Effective length of query: 263 Effective length of database: 269 Effective search space: 70747 Effective search space used: 70747 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory