GapMind for Amino acid biosynthesis

 

Alignments for a candidate for hom_kinase in Pseudomonas putida KT2440

Align Homoserine kinase; HK; HSK; EC 2.7.1.39 (characterized)
to candidate PP_0121 PP_0121 homoserine kinase

Query= SwissProt::P29364
         (316 letters)



>FitnessBrowser__Putida:PP_0121
          Length = 316

 Score =  457 bits (1175), Expect = e-133
 Identities = 223/316 (70%), Positives = 257/316 (81%)

Query: 1   MSVFTPLERSTLEAFLAPYDLGRLRDFRGIAEGSENSNFFVSLEHGEFVLTLVERGPVQD 60
           MSVFTP+ R  LE FLAPY+LGRL DF+GIA G+ENSNFFVSLE GEFVLTL+ERGP +D
Sbjct: 1   MSVFTPVTRPELETFLAPYELGRLLDFQGIAAGTENSNFFVSLEQGEFVLTLIERGPSED 60

Query: 61  LPFFIELLDVLHEDGLPVPYALRTRDGEALRRLEGKPALLQPRLAGRHERQPNAHHCQEV 120
           +PFFIELLD LH   +PVPYA+R RDG  LR L GKPALLQPRL+G+H + PN  HC +V
Sbjct: 61  MPFFIELLDTLHGADMPVPYAIRDRDGNGLRELCGKPALLQPRLSGKHIKAPNNQHCAQV 120

Query: 121 GDLLGHLHAATRGRILERPSDRGLPWMLEQGANLAPRLPEQARALLAPALAEIAALDAER 180
           G+LL H+H ATR  I+ER +DRGL WML  GA L PRL  +  ALL PAL EI+A  A+ 
Sbjct: 121 GELLAHIHLATREHIIERRTDRGLDWMLASGAELLPRLTAEQAALLQPALDEISAHKAQI 180

Query: 181 PALPRANLHADLFRDNVLFDGPHLAGLIDFYNACSGWMLYDLAITLNDWCSNTDGSLDPA 240
            ALPRANLHADLFRDNV+F+G HL G+IDFYNACSG MLYD+AIT+NDWC +  G++D  
Sbjct: 181 LALPRANLHADLFRDNVMFEGTHLTGVIDFYNACSGPMLYDIAITVNDWCLDEQGAVDVP 240

Query: 241 RARALLAAYANRRPFTALEAEHWPSMLRVACVRFWLSRLIAAEAFAGQDVLIHDPAEFEI 300
           RA+ALLAAYA  RPFTA EAE WP MLRV CVRFWLSRLIAAE+FAG DV+IHDP+EFE+
Sbjct: 241 RAQALLAAYAALRPFTAAEAELWPEMLRVGCVRFWLSRLIAAESFAGMDVMIHDPSEFEV 300

Query: 301 RLAQRQNVEIHLPFAL 316
           RLAQRQ V +HLPFAL
Sbjct: 301 RLAQRQQVALHLPFAL 316


Lambda     K      H
   0.324    0.140    0.434 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 382
Number of extensions: 7
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 316
Length of database: 316
Length adjustment: 27
Effective length of query: 289
Effective length of database: 289
Effective search space:    83521
Effective search space used:    83521
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 48 (23.1 bits)

Align candidate PP_0121 PP_0121 (homoserine kinase)
to HMM TIGR00938 (thrB: homoserine kinase (EC 2.7.1.39))

Software error:

../bin/blast/fastacmd -i /tmp/list.15253.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.15253.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.