Align Beta-phenylalanine transaminase; Aromatic beta-amino acid aminotransferase; Beta-phenylalanine aminotransferase; VpAT; EC 2.6.1.- (characterized)
to candidate PP_4784 PP_4784 Glutamate-1-semialdehyde 2,1-aminomutase
Query= SwissProt::H8WR05 (434 letters) >FitnessBrowser__Putida:PP_4784 Length = 427 Score = 205 bits (521), Expect = 3e-57 Identities = 127/397 (31%), Positives = 193/397 (48%), Gaps = 22/397 (5%) Query: 24 SQRQFEAQARYMPGANSRSVLFYAPF---PLTIARGEGAALWDADGHRYADFIAEYTAGV 80 S+ F +++PG + V + PL EGA + D D RY D++ + + Sbjct: 4 SEALFAQAQKHIPGGVNSPVRAFKSVGGTPLFFKHAEGAYVVDEDDKRYVDYVGSWGPMI 63 Query: 81 YGHSAPEIRDAVIEAMQGGINLTGHNLLEGRLARLICERFPQIEQLRFTNSGTEANLMAL 140 GH P++ D+V ++ G++ +E +A L+C P +E +R +SGTEA + A+ Sbjct: 64 LGHGHPDVLDSVRRQLEHGLSYGAPTAMETEMADLVCSIVPSMEMVRMVSSGTEATMSAI 123 Query: 141 TAALHFTGRRKIVVFSGGYHG-----------GVLGFGARPSPTTVPFDF----LVLPYN 185 A +TGR I+ F G YHG G+L G PS VP DF L LP+N Sbjct: 124 RLARGYTGRDAIIKFEGCYHGHSDSLLVKAGSGLLTQGV-PSSAGVPADFAKHTLTLPFN 182 Query: 186 DAQTARAQIERHGPEIAVVLVEPMQGASGCIPGQPDFLQALRESATQVGALLVFDEVMTS 245 D + G +A ++VEP+ G C+P P FL+ LRE + G +L+FDEVMT Sbjct: 183 DIAAVEKTLAEVGQTVACIIVEPVAGNMNCVPPAPGFLEGLREQCDKHGVVLIFDEVMTG 242 Query: 246 -RLAPHGLANKLGIRSDLTTLGKYIGGGMSFGAFGGRADVMALFDPRTGPLAHSGTFNNN 304 R++ G GI+ DL+T GK +GGGM G FGG+ ++M P GP+ +GT + N Sbjct: 243 FRVSLGGAQGHYGIKPDLSTFGKIVGGGMPVGCFGGKREIMGCIAP-LGPVYQAGTLSGN 301 Query: 305 VMTMAAGYAGLTKLFTPEAAGALAERGEALRARLNALCANEGVAMQFTGIGSLMNAHFV- 363 + MAAG L + P L + + L GV T G++ +F Sbjct: 302 PLAMAAGLTTLKLISRPGFHAELTDYTSRMLDGLQQRADAAGVPFVTTQAGAMFGLYFSG 361 Query: 364 QGDVRSSEDLAAVDGRLRQLLFFHLLNEDIYSSPRGF 400 D+ + ED+ A D + F +L+ +Y +P F Sbjct: 362 ADDIVTFEDVMASDAERFKRFFHLMLDGGVYLAPSAF 398 Lambda K H 0.322 0.138 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 505 Number of extensions: 25 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 434 Length of database: 427 Length adjustment: 32 Effective length of query: 402 Effective length of database: 395 Effective search space: 158790 Effective search space used: 158790 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory