GapMind for Amino acid biosynthesis

 

Aligments for a candidate for cmutase in Pseudomonas putida KT2440

Align Bifunctional chorismate mutase/prephenate dehydratase; Chorismate mutase-prephenate dehydratase; P-protein; EC 5.4.99.5; EC 4.2.1.51 (characterized)
to candidate PP_1769 PP_1769 chorismate mutase/Prephenate dehydratase

Query= SwissProt::P27603
         (365 letters)



>lcl|FitnessBrowser__Putida:PP_1769 PP_1769 chorismate
           mutase/Prephenate dehydratase
          Length = 367

 Score =  630 bits (1626), Expect = 0.0
 Identities = 316/365 (86%), Positives = 343/365 (93%), Gaps = 1/365 (0%)

Query: 1   MSEADQLKALRVRIDSLDERILDLISERARCAQEVARVKTASWPKAEEAVFYRPEREAWV 60
           MSE  +LKALRVRIDSLDE+IL+LIS+RARCA+EVARVKTAS  + E+ VFYRPEREA V
Sbjct: 4   MSE-QELKALRVRIDSLDEKILELISDRARCAEEVARVKTASLKEGEKPVFYRPEREAAV 62

Query: 61  LKHIMELNKGPLDNEEMARLFREIMSSCLALEQPLRVAYLGPEGTFSQAAALKHFGHSVI 120
           LK +ME NKGPL NEEMARLFREIMSSCLALE+PL++AYLGPEGTF+QAAA+KHFGH+VI
Sbjct: 63  LKRVMERNKGPLGNEEMARLFREIMSSCLALEEPLKIAYLGPEGTFTQAAAMKHFGHAVI 122

Query: 121 SKPMAAIDEVFREVVAGAVNFGVVPVENSTEGAVNHTLDSFLEHDIVICGEVELRIHHHL 180
           S+PMAAIDEVFREV AGAVNFGVVPVENSTEGAV+HTLDSFLEHD+VICGEVELRIHHHL
Sbjct: 123 SRPMAAIDEVFREVAAGAVNFGVVPVENSTEGAVSHTLDSFLEHDMVICGEVELRIHHHL 182

Query: 181 LVGETTKTDRITRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNADAAKRVKSEWNSAAIA 240
           LVGE TKTD ITRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNA+AAKRVK EWNSAAIA
Sbjct: 183 LVGENTKTDSITRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNAEAAKRVKGEWNSAAIA 242

Query: 241 GDMAAQLYGLSKLAEKIEDRPVNSTRFLIIGSQEVPPTGDDKTSIIVSMRNKPGALHELL 300
           GDMAA LYGL++LAEKIEDRP NSTRFL+IG+QEVPPTGDDKTSIIVSM NKPGALHELL
Sbjct: 243 GDMAANLYGLTRLAEKIEDRPDNSTRFLMIGNQEVPPTGDDKTSIIVSMSNKPGALHELL 302

Query: 301 MPFHSNGIDLTRIETRPSRSGKWTYVFFIDCMGHHQDPLIKNVLEKIGHEAVALKVLGSY 360
           +PF+ NGIDLTRIETRPSRSGKWTYVFFID +GHH+DPLIK VLE+I  EAVALKVLGSY
Sbjct: 303 VPFYQNGIDLTRIETRPSRSGKWTYVFFIDFVGHHRDPLIKAVLEQISQEAVALKVLGSY 362

Query: 361 PKAVL 365
           PKAVL
Sbjct: 363 PKAVL 367


Lambda     K      H
   0.319    0.133    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 521
Number of extensions: 10
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 365
Length of database: 367
Length adjustment: 30
Effective length of query: 335
Effective length of database: 337
Effective search space:   112895
Effective search space used:   112895
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 49 (23.5 bits)

Align candidate PP_1769 PP_1769 (chorismate mutase/Prephenate dehydratase)
to HMM TIGR01807 (pheA: chorismate mutase (EC 5.4.99.5))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR01807.hmm
# target sequence database:        /tmp/gapView.21793.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01807  [M=76]
Accession:   TIGR01807
Description: CM_P2: chorismate mutase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                           Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                           -----------
    4.6e-35  106.0   2.7      5e-35  105.9   1.2    1.9  2  lcl|FitnessBrowser__Putida:PP_1769  PP_1769 chorismate mutase/Prephe


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Putida:PP_1769  PP_1769 chorismate mutase/Prephenate dehydratase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  105.9   1.2     5e-35     5e-35       1      76 []       9      87 ..       9      87 .. 0.96
   2 ?   -3.0   0.0      0.51      0.51      67      75 ..     128     136 ..     125     137 .. 0.80

  Alignments for each domain:
  == domain 1  score: 105.9 bits;  conditional E-value: 5e-35
                           TIGR01807  1 LkelRnkiDaiDdrildLlseRaklakavgelKkks...aseaviYRPeREaavlrrlkelnkGpLdqeavarifrE 74
                                        Lk+lR++iD++D++il+L+s+Ra++a++v+++K++s    ++ v+YRPeREaavl+r++e+nkGpL +e++ar+frE
  lcl|FitnessBrowser__Putida:PP_1769  9 LKALRVRIDSLDEKILELISDRARCAEEVARVKTASlkeGEKPVFYRPEREAAVLKRVMERNKGPLGNEEMARLFRE 85
                                        799********************************976667789********************************* PP

                           TIGR01807 75 im 76
                                        im
  lcl|FitnessBrowser__Putida:PP_1769 86 IM 87
                                        *9 PP

  == domain 2  score: -3.0 bits;  conditional E-value: 0.51
                           TIGR01807  67 avarifrEi 75 
                                         a++ +frE+
  lcl|FitnessBrowser__Putida:PP_1769 128 AIDEVFREV 136
                                         789999998 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (76 nodes)
Target sequences:                          1  (367 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00
# Mc/sec: 7.79
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory