GapMind for Amino acid biosynthesis

 

Alignments for a candidate for argB in Pseudomonas putida KT2440

Align acetylglutamate kinase (EC 2.7.2.8) (characterized)
to candidate PP_5289 PP_5289 Acetylglutamate kinase

Query= BRENDA::Q9HTN2
         (301 letters)



>FitnessBrowser__Putida:PP_5289
          Length = 301

 Score =  541 bits (1395), Expect = e-159
 Identities = 277/299 (92%), Positives = 289/299 (96%)

Query: 1   MTLSRDDAAQVAKVLSEALPYIRRFVGKTLVIKYGGNAMESEELKAGFARDVVLMKAVGI 60
           MTL RD A+ VA+VLSEALPYIRRFVGKTLVIKYGGNAMESEELK GFARD+VLMKAVGI
Sbjct: 1   MTLDRDAASHVAEVLSEALPYIRRFVGKTLVIKYGGNAMESEELKTGFARDIVLMKAVGI 60

Query: 61  NPVVVHGGGPQIGDLLKRLSIESHFIDGMRVTDAATMDVVEMVLGGQVNKDIVNLINRHG 120
           NPVVVHGGGPQIGDLLKRLSIESHFIDGMRVTD+ATMDVVEMVLGGQVNKDIVNLINRHG
Sbjct: 61  NPVVVHGGGPQIGDLLKRLSIESHFIDGMRVTDSATMDVVEMVLGGQVNKDIVNLINRHG 120

Query: 121 GSAIGLTGKDAELIRAKKLTVTRQTPEMTKPEIIDIGHVGEVTGVNVGLLNMLVKGDFIP 180
           GSAIGLTGKDAELIRA+KLTV+RQTPEMT PEIIDIGHVGEV  VN  LLNMLVKGDFIP
Sbjct: 121 GSAIGLTGKDAELIRARKLTVSRQTPEMTTPEIIDIGHVGEVVSVNTDLLNMLVKGDFIP 180

Query: 181 VIAPIGVGSNGESYNINADLVAGKVAEALKAEKLMLLTNIAGLMDKQGQVLTGLSTEQVN 240
           VIAPIGVG+NGESYNINADLVAGKVAEALKAEKLMLLTNIAGLMDKQGQVLTGL+TEQVN
Sbjct: 181 VIAPIGVGANGESYNINADLVAGKVAEALKAEKLMLLTNIAGLMDKQGQVLTGLTTEQVN 240

Query: 241 ELIADGTIYGGMLPKIRCALEAVQGGVTSAHIIDGRVPNAVLLEIFTDSGVGTLISNRK 299
           ELIADGTIYGGMLPKI+CAL+AVQGGV S+HIIDGRVPNAVLLEIFTDSGVGTLI+NRK
Sbjct: 241 ELIADGTIYGGMLPKIKCALDAVQGGVNSSHIIDGRVPNAVLLEIFTDSGVGTLITNRK 299


Lambda     K      H
   0.318    0.138    0.381 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 469
Number of extensions: 10
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 301
Length of database: 301
Length adjustment: 27
Effective length of query: 274
Effective length of database: 274
Effective search space:    75076
Effective search space used:    75076
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 48 (23.1 bits)

Align candidate PP_5289 PP_5289 (Acetylglutamate kinase)
to HMM TIGR00761 (argB: acetylglutamate kinase (EC 2.7.2.8))

Software error:

../bin/blast/fastacmd -i /tmp/list.27697.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.27697.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.