Align phosphoglycerate dehydrogenase (EC 1.1.1.95) (characterized)
to candidate PP_1261 PP_1261 2-ketoaldonate reductase / hydroxypyruvate/glyoxylate reductase
Query= BRENDA::O58256 (333 letters) >FitnessBrowser__Putida:PP_1261 Length = 324 Score = 176 bits (445), Expect = 9e-49 Identities = 102/272 (37%), Positives = 158/272 (58%), Gaps = 8/272 (2%) Query: 53 KITREVLENAERLKVISCHSAGYDNIDLEEATKRGIYVTKVSGLLSEAVAEFTVGLIINL 112 K+ R LE A RL+V+S S GYDN DL+ +RGI +T +L+E+ A+ LI+ Sbjct: 55 KLGRAQLEGAARLEVVSSVSVGYDNYDLDYFNERGIALTNTPDVLTESTADLGFSLIMGC 114 Query: 113 MRKIHYADKFIRRGEWESHAKIWTGFKRIES-LYGKKVGILGMGAIGKAIARR-LIPFGV 170 R+ D + + G W++ G S ++GK +GI+GMG IG A+ARR F + Sbjct: 115 ARRTAELDAWTKAGNWQA----TVGPAHFGSDVHGKTLGIVGMGNIGAAVARRGRFGFNM 170 Query: 171 KLYYWSRHRKVNVEKELKARYMDIDELLEKSDIVILALPLTRDTYHIINEERVKKLE-GK 229 + Y RK +EKEL A++ +D+LL ++D V++ +PL+ T +I+ +K ++ Sbjct: 171 PILYSGNSRKTALEKELGAQFRSLDQLLAEADFVVIVVPLSDATRKLISSRELKLMKPSA 230 Query: 230 YLVNIGRGALVDEKAVTEAIKQGKLKGYATDVFEKEPVREHELFKYEWETVLTPHYAGLA 289 +L+NI RG +VDE A+ EA++ G ++G DV+EKEP+ + LFK + PH Sbjct: 231 FLINIARGPVVDEAALIEALQAGTIRGTGLDVYEKEPLSDSPLFKLP-NALTLPHIGSAT 289 Query: 290 LEAQEDVGFRAVENLLKVLRGEVPEDLVNKEV 321 E +E + RA++NL L GE P DLVN +V Sbjct: 290 AETREAMANRAIDNLRAALLGERPRDLVNPQV 321 Lambda K H 0.319 0.139 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 260 Number of extensions: 19 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 333 Length of database: 324 Length adjustment: 28 Effective length of query: 305 Effective length of database: 296 Effective search space: 90280 Effective search space used: 90280 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory