Align Anthranilate synthase component 2; AS; ASII; Anthranilate synthase, GATase component; Anthranilate synthase, glutamine amidotransferase component; EC 4.1.3.27 (characterized)
to candidate PP_0420 PP_0420 aminodeoxychorismate synthase / para-aminobenzoate synthase multi-enzyme complex
Query= SwissProt::P00901 (198 letters) >FitnessBrowser__Putida:PP_0420 Length = 197 Score = 389 bits (999), Expect = e-113 Identities = 190/197 (96%), Positives = 194/197 (98%) Query: 2 LLMMIDNYDSFTYNVVQYLGELGAEVKVIRNDEMTIAQIEALNPERIVVSPGPCTPSEAG 61 +L+MIDNYDSFTYNVVQYLGELGAEVKVIRNDEMTIAQIEALNPERIVVSPGPCTPSEAG Sbjct: 1 MLLMIDNYDSFTYNVVQYLGELGAEVKVIRNDEMTIAQIEALNPERIVVSPGPCTPSEAG 60 Query: 62 VSIEAILHFAGKLPILGVCLGHQSIGQAFGGDVVRARQVMHGKTSPVHHRDLGVFTGLNN 121 VSIEAILHFAGKLPILGVCLGHQSIGQAFGGDVVRARQVMHGKTSPV+HRDLGVF LNN Sbjct: 61 VSIEAILHFAGKLPILGVCLGHQSIGQAFGGDVVRARQVMHGKTSPVYHRDLGVFASLNN 120 Query: 122 PLTVTRYHSLVVKRETLPDCLEVTAWTAHEDGSVDEIMGLRHKTLNIEGVQFHPESILTE 181 PLTVTRYHSLVVKRETLPDCLEVTAWT+H DGSVDEIMGLRHKTLNIEGVQFHPESILTE Sbjct: 121 PLTVTRYHSLVVKRETLPDCLEVTAWTSHADGSVDEIMGLRHKTLNIEGVQFHPESILTE 180 Query: 182 QGHELFANFLKQTGGRR 198 QGHELFANFLKQTGGRR Sbjct: 181 QGHELFANFLKQTGGRR 197 Lambda K H 0.320 0.138 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 247 Number of extensions: 1 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 198 Length of database: 197 Length adjustment: 20 Effective length of query: 178 Effective length of database: 177 Effective search space: 31506 Effective search space used: 31506 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 45 (21.9 bits)
Align candidate PP_0420 PP_0420 (aminodeoxychorismate synthase / para-aminobenzoate synthase multi-enzyme complex)
to HMM TIGR00566 (glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase)
../bin/blast/fastacmd -i /tmp/list.4506.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.4506.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.
For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.