GapMind for Amino acid biosynthesis

 

Protein 6936711 in Shewanella amazonensis SB2B

Annotation: FitnessBrowser__SB2B:6936711

Length: 659 amino acids

Source: SB2B in FitnessBrowser

Candidate for 6 steps in Amino acid biosynthesis

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-phenylalanine biosynthesis preph-dehydratase hi P-protein; EC 4.2.1.51; EC 5.4.99.5 (characterized) 55% 99% 411
L-phenylalanine biosynthesis cmutase med P-protein; EC 4.2.1.51; EC 5.4.99.5 (characterized) 55% 99% 411 prephenate dehydratase (EC 4.2.1.51) 55% 410.2
L-phenylalanine biosynthesis cmutase med chorismate mutase (EC 5.4.99.5) (TIGR01797) 100% 87.9 prephenate dehydratase (EC 4.2.1.51) 55% 410.2
L-tyrosine biosynthesis cmutase med P-protein; EC 4.2.1.51; EC 5.4.99.5 (characterized) 55% 99% 411 prephenate dehydratase (EC 4.2.1.51) 55% 410.2
L-tyrosine biosynthesis cmutase med chorismate mutase (EC 5.4.99.5) (TIGR01797) 100% 87.9 prephenate dehydratase (EC 4.2.1.51) 55% 410.2
L-phenylalanine biosynthesis aro-dehydratase med arogenate dehydratase (EC 4.2.1.91) (characterized) 32% 81% 164.1
chorismate biosynthesis aroG med 3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54) (characterized) 34% 82% 104.4
L-tyrosine biosynthesis pre-dehydr lo prephenate dehydrogenase (EC 1.3.1.12); prephenate dehydratase (EC 4.2.1.51); Chorismate mutase (EC 5.4.99.5) (characterized) 30% 57% 170.6 P-protein; EC 4.2.1.51; EC 5.4.99.5 55% 411.0

Sequence Analysis Tools

View 6936711 at FitnessBrowser

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MEKPQPLSETREQITDIDNTVLQLLARRRELSLEVARSKEVDVRPVRDTQRERELLSRLV
QKGREQGLDPHFVMQLYQSIIEDSVLNQQAYLHGRANPETQKQQYCIAYLGARGSYSYLA
ANRYCQRRQVDMVDLGCQSFDEIVHAVESGHADYGFLPIENTSSGSINEVYDVLQHTSLA
IVGETTIEVGHCLLAKPGTKASDIKTLYAHPQPISQCSRYLARHPGLRLEYCASSAEAME
KVQAADSKDVAAIGSAEGGGLYQLEAIEKGLANQKVNQSRFIVVARKAVAVPEQLPAKCT
LIMATGQKPGALVEALLVLKANNLNMSKLESRPIPGTPWEEMFYLDIDANLASVPMQLAL
KELERITRFIKVLGCYPCETVAPTQLSNAQLLIEPEHFRTDAPEPAAAQARDGDSVPARH
SLGYKETVSEVQAGALLIGNGHSGALAMLSLPDTLEGFEPFLKQLKAAGFAGLVLDNLSE
RPDPAKALDACTKAAEKFGLITAAAVNREDELEHAISRVELILIRGKQMFNQPLLERLGK
LHLPVVLERNTMADIDELLAAADTILAEGNQQLMLCESGVSSFKSSTLATLDLAGLVELK
ARSHLPVLVNPSYAVTPEACPRQAKAVKRLGADGLLLEVSLDTSMADSYLGETLRQFFV

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory