GapMind for Amino acid biosynthesis

 

Aligments for a candidate for argB in Shewanella amazonensis SB2B

Align acetylglutamate kinase; EC 2.7.2.8 (characterized)
to candidate 6936060 Sama_0257 acetylglutamate kinase (RefSeq)

Query= CharProtDB::CH_001694
         (258 letters)



>lcl|FitnessBrowser__SB2B:6936060 Sama_0257 acetylglutamate kinase
           (RefSeq)
          Length = 262

 Score =  224 bits (571), Expect = 1e-63
 Identities = 117/252 (46%), Positives = 167/252 (66%), Gaps = 1/252 (0%)

Query: 5   LIIKLGGVLLDSEEALERLFSALVNYRESHQRPLVIVHGGGCVVDELMKGLNLPVKKKNG 64
           L++K+GG LL  E  + RL        E  ++ +V+VHGGGC+VDE +K   +   K +G
Sbjct: 8   LVLKVGGALLQCEMGMARLMDTARQLLEKGEQ-VVLVHGGGCLVDEQLKANGMETVKLDG 66

Query: 65  LRVTPADQIDIITGALAGTANKTLLAWAKKHQIAAVGLFLGDGDSVKVTQLDEELGHVGL 124
           LRVTPA+Q+ II GALAGT+NK L   A K  + ++G+ L D + V     DE LG VG 
Sbjct: 67  LRVTPAEQMPIIAGALAGTSNKLLQGAAAKAGVVSMGMSLCDANMVTAVIKDERLGMVGE 126

Query: 125 AQPGSPKLINSLLENGYLPVVSSIGVTDEGQLMNVNADQAATALAATLGADLILLSDVSG 184
             P   K +  +L  G+LP++SSI + ++G+L+NVNADQAA+ LA  LG  L+LLSDVSG
Sbjct: 127 VSPKDAKALEFILAQGWLPIISSIAMGEDGELLNVNADQAASVLAKLLGGKLVLLSDVSG 186

Query: 185 ILDGKGQRIAEMTAAKAEQLIEQGIITDGMIVKVNAALDAARTLGRPVDIASWRHAEQLP 244
           +LDGKG+ I  + + + ++L++ G+I  GM VKV AAL+ A+ LG+PV +ASWR + Q+ 
Sbjct: 187 VLDGKGKLIPSLNSQEIDELVKLGVIEKGMKVKVEAALEVAQWLGQPVQVASWRDSGQMA 246

Query: 245 ALFNGMPMGTRI 256
           AL  G  +GT+I
Sbjct: 247 ALIKGEAVGTQI 258


Lambda     K      H
   0.317    0.136    0.381 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 218
Number of extensions: 8
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 258
Length of database: 262
Length adjustment: 24
Effective length of query: 234
Effective length of database: 238
Effective search space:    55692
Effective search space used:    55692
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 47 (22.7 bits)

Align candidate 6936060 Sama_0257 (acetylglutamate kinase (RefSeq))
to HMM TIGR00761 (argB: acetylglutamate kinase (EC 2.7.2.8))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR00761.hmm
# target sequence database:        /tmp/gapView.24879.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00761  [M=231]
Accession:   TIGR00761
Description: argB: acetylglutamate kinase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                         Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                         -----------
    6.5e-61  191.8   5.9    7.5e-61  191.6   5.9    1.0  1  lcl|FitnessBrowser__SB2B:6936060  Sama_0257 acetylglutamate kinase


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__SB2B:6936060  Sama_0257 acetylglutamate kinase (RefSeq)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  191.6   5.9   7.5e-61   7.5e-61       2     229 ..       8     234 ..       7     236 .. 0.95

  Alignments for each domain:
  == domain 1  score: 191.6 bits;  conditional E-value: 7.5e-61
                         TIGR00761   2 iViKiGGaais..elleelakdiaklrkegiklvivHGGgpeinelleklgievefvnglRvTdketlevvemvlig 76 
                                       +V+K+GGa+++    + +l++ + +l ++g ++v+vHGGg+ ++e l++ g+e+ +++glRvT +e++ ++  +l+g
  lcl|FitnessBrowser__SB2B:6936060   8 LVLKVGGALLQceMGMARLMDTARQLLEKGEQVVLVHGGGCLVDEQLKANGMETVKLDGLRVTPAEQMPIIAGALAG 84 
                                       79*********944478999********************************************************* PP

                         TIGR00761  77 kvnkelvallekhgikavGltgkDgqlltaekldkedlgyvGeikkvnkelleallkagiipviaslaldeegqllN 153
                                       + nk l  + +k+g+  +G++  D++++ta   d+ +lg+vGe++  ++++le +l++g +p+i+s+a+ e+g+llN
  lcl|FitnessBrowser__SB2B:6936060  85 TSNKLLQGAAAKAGVVSMGMSLCDANMVTAVIKDE-RLGMVGEVSPKDAKALEFILAQGWLPIISSIAMGEDGELLN 160
                                       ***************************99976555.5**************************************** PP

                         TIGR00761 154 vnaDtaAaelAaaleAekLvlLtdvaGilegdkksliseleleeieqlikqavikgGmipKveaalealesgvkkv 229
                                       vnaD+aA+ lA+ l+ + LvlL+dv+G+l+g k +li +l+ +ei++l+k +vi++Gm+ Kveaale ++ + + v
  lcl|FitnessBrowser__SB2B:6936060 161 VNADQAASVLAKLLGGK-LVLLSDVSGVLDG-KGKLIPSLNSQEIDELVKLGVIEKGMKVKVEAALEVAQWLGQPV 234
                                       ***************99.*************.666********************************998777666 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (231 nodes)
Target sequences:                          1  (262 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00
# Mc/sec: 7.24
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory