Align N-acetylornithine carbamoyltransferase (EC 2.1.3.9) (characterized)
to candidate 6936061 Sama_0258 ornithine carbamoyltransferase (RefSeq)
Query= BRENDA::Q8P8J2 (339 letters) >FitnessBrowser__SB2B:6936061 Length = 301 Score = 140 bits (352), Expect = 5e-38 Identities = 104/336 (30%), Positives = 162/336 (48%), Gaps = 38/336 (11%) Query: 3 LKHFLNTQDWSRAELDALLTQAALFKRN--KLGSELKGKSIALVFFNPSMRTRTSFELGA 60 +KH ++ ++ ++ ++ LLT A K + K L GKS+ ++F PS+RTR SF++G Sbjct: 1 MKHLISIKELTQKQMLDLLTLAKEIKADPAKYSRALAGKSVVMLFEKPSLRTRVSFDIGI 60 Query: 61 FQLGGHAVVLQPGKDAWPIEFNLGTVMDGDTEEHIAEVARVLGRYVDLIGVRAFPKFVDW 120 +LGGH + L A LG E + + A L + D I R F Sbjct: 61 NKLGGHCLYLDQQNGA------LGK------RESVKDFASNLSCWADAIVARTFAH---- 104 Query: 121 SKDREDQVLKSFAKYSPVPVIN-METITHPCQELAHALALQEHFGTPDLRGKKYVLTWTY 179 + ++ AKY VPVIN + + HPCQ LA L+L E F YV Sbjct: 105 ------ETVEGLAKYGRVPVINALSDLYHPCQGLADFLSLAEKFDDLSKVRLAYVGD--- 155 Query: 180 HPKPLNTAVANSALTIATRMGMDVTLLCPTPDYILDERYMDWAAQNVAESGGSLQVSHDI 239 V++S + A +G +T++CP P + D + A Q A GG L ++ DI Sbjct: 156 -----GNNVSHSLMYGAALLGATMTVICP-PGHFPDGFEVQQAQQIAAAHGGKLVLTSDI 209 Query: 240 DSAYAGADVVYAKSWGALPFFGNWEPEKPIRDQYQHFIVDERKMALTNNGVFSHCLPLRR 299 + A G D VY +W ++ G+ I+ ++ + V++ M F HCLP R Sbjct: 210 N-AIEGHDAVYTDTWISM---GDNTALTDIKAKFAPYQVNKALMNKAGASYFMHCLPAHR 265 Query: 300 NVKATDAVMDSPNCIAIDEAENRLHVQKAIMAALVG 335 ++ TD VMD + +D+AENR+H Q A++ L+G Sbjct: 266 GLEVTDEVMDGEGSLILDQAENRMHAQNAVLVTLLG 301 Lambda K H 0.320 0.134 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 229 Number of extensions: 14 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 339 Length of database: 301 Length adjustment: 28 Effective length of query: 311 Effective length of database: 273 Effective search space: 84903 Effective search space used: 84903 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory