GapMind for Amino acid biosynthesis

 

Alignments for a candidate for cysE in Shewanella amazonensis SB2B

Align serine O-acetyltransferase (EC 2.3.1.30) (characterized)
to candidate 6938137 Sama_2258 putative acetyltransferase (RefSeq)

Query= BRENDA::P95231
         (229 letters)



>FitnessBrowser__SB2B:6938137
          Length = 193

 Score = 53.1 bits (126), Expect = 4e-12
 Identities = 39/130 (30%), Positives = 57/130 (43%), Gaps = 21/130 (16%)

Query: 59  FTRILTGVDIHPGAVIGARVFIDHATGVVIGETAEVGDDVTIYHGVTLGGSGMVGGK--- 115
           F  +  G  I  G  +G  VF+ +   V IG   +V ++V+IY  V +      G     
Sbjct: 26  FVHVCGGAKIGSGCSLGQNVFVGNR--VTIGNNVKVQNNVSIYDNVFVEDDVFCGPSMVF 83

Query: 116 ----------------RHPTVGDRVIIGAGAKVLGPIKIGEDSRIGANAVVVKPVPPSAV 159
                           R   V     +GA   ++  + IGE + +GA AV+ K V P A+
Sbjct: 84  TNVYNPRSFIERKTEYRDTLVKRGATLGANCTIVCGVTIGEYALVGAGAVINKDVKPFAL 143

Query: 160 VVGVPGQVIG 169
           VVGVPG+ IG
Sbjct: 144 VVGVPGKQIG 153


Lambda     K      H
   0.321    0.141    0.443 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 134
Number of extensions: 11
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 229
Length of database: 193
Length adjustment: 21
Effective length of query: 208
Effective length of database: 172
Effective search space:    35776
Effective search space used:    35776
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 45 (21.9 bits)

This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory