GapMind for Amino acid biosynthesis

 

Aligments for a candidate for serC in Shewanella amazonensis SB2B

Align phosphoserine aminotransferase; EC 2.6.1.52 (characterized)
to candidate 6937577 Sama_1732 phosphoserine aminotransferase (RefSeq)

Query= CharProtDB::CH_002572
         (362 letters)



>lcl|FitnessBrowser__SB2B:6937577 Sama_1732 phosphoserine
           aminotransferase (RefSeq)
          Length = 364

 Score =  406 bits (1043), Expect = e-118
 Identities = 207/364 (56%), Positives = 262/364 (71%), Gaps = 5/364 (1%)

Query: 1   MAQIFNFSSGPAMLPAEVLKQAQQELRDWNGLGTSVMEVSHRGKEFIQVAEEAEKDFRDL 60
           M+ ++NF +GPAMLPA V+K+AQ EL DWNG G SVMEVSHRG  FIQ+A+++E D R+L
Sbjct: 1   MSAVYNFCAGPAMLPAAVMKKAQAELLDWNGQGVSVMEVSHRGAPFIQLAKDSEADLREL 60

Query: 61  LNVPSNYKVLFCHGGGRGQFAAVPLNILGDKTTADYVDAGYWAASAIKEAKKYCTPNVFD 120
           +N+P NY VLF HGGGRGQF+AV  N LGD   A Y+ +G W+ +A +EAKK    N  D
Sbjct: 61  MNIPDNYHVLFMHGGGRGQFSAVVNNFLGDNGKALYLVSGQWSKAATEEAKKLAGDNSID 120

Query: 121 AKVTVDGLRAVKPMREWQLSDNAA---YMHYCPNETIDGIAIDETPDFGADVVVAADFSS 177
               V+ +  +  +    LS N +   Y+HYCPNET+DGI I +  D  +   + AD SS
Sbjct: 121 VINVVEKVNGLNKVVIPALSGNGSEYRYLHYCPNETVDGIEIFD--DIDSPWPIVADMSS 178

Query: 178 TILSRPIDVSRYGVIYAGAQKNIGPAGLTIVIVREDLLGKANIACPSILDYSILNDNGSM 237
            I+SR IDVSR+ +IYAGAQKNIGP+GL+IVIVR+D+L    +   SI+DY +  +N SM
Sbjct: 179 NIMSREIDVSRFALIYAGAQKNIGPSGLSIVIVRKDMLELPQLTQSSIMDYRLTAENDSM 238

Query: 238 FNTPPTFAWYLSGLVFKWLKANGGVAEMDKINQQKAELLYGVIDNSDFYRNDVAKANRSR 297
           +NTPPTFAWYL+  VFKWLK+ GG+  M ++N +KA  LY  ID+ DFY+N VA  NRS+
Sbjct: 239 YNTPPTFAWYLAAEVFKWLKSVGGIKGMAEVNAEKARRLYACIDSLDFYKNGVAPQNRSQ 298

Query: 298 MNVPFQLADSALDKLFLEESFAAGLHALKGHRVVGGMRASIYNAMPLEGVKALTDFMVEF 357
           MNV FQLAD +LDK FL+E+ A GL ALKGHR+VGGMRASIYNAMPLEGV AL  FM  F
Sbjct: 299 MNVTFQLADESLDKDFLKEAEALGLVALKGHRIVGGMRASIYNAMPLEGVDALVSFMRSF 358

Query: 358 ERRH 361
             +H
Sbjct: 359 AAKH 362


Lambda     K      H
   0.319    0.136    0.405 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 395
Number of extensions: 18
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 362
Length of database: 364
Length adjustment: 29
Effective length of query: 333
Effective length of database: 335
Effective search space:   111555
Effective search space used:   111555
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 49 (23.5 bits)

Align candidate 6937577 Sama_1732 (phosphoserine aminotransferase (RefSeq))
to HMM TIGR01364 (serC: phosphoserine transaminase (EC 2.6.1.52))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR01364.hmm
# target sequence database:        /tmp/gapView.2186.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01364  [M=358]
Accession:   TIGR01364
Description: serC_1: phosphoserine transaminase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                         Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                         -----------
   1.8e-148  480.1   0.0   2.1e-148  479.9   0.0    1.0  1  lcl|FitnessBrowser__SB2B:6937577  Sama_1732 phosphoserine aminotra


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__SB2B:6937577  Sama_1732 phosphoserine aminotransferase (RefSeq)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  479.9   0.0  2.1e-148  2.1e-148       1     358 []       4     362 ..       4     362 .. 0.94

  Alignments for each domain:
  == domain 1  score: 479.9 bits;  conditional E-value: 2.1e-148
                         TIGR01364   1 ivnFsaGPaalpeevlekaqkelldfnglglsvmeisHRskefekvveeaesdlreLlnipdnyevlflqGGattqf 77 
                                       ++nF+aGPa+lp +v++kaq+elld+ng+g+svme+sHR   f ++++++e dlreL+nipdny+vlf+ GG+++qf
  lcl|FitnessBrowser__SB2B:6937577   4 VYNFCAGPAMLPAAVMKKAQAELLDWNGQGVSVMEVSHRGAPFIQLAKDSEADLRELMNIPDNYHVLFMHGGGRGQF 80 
                                       59*************************************************************************** PP

                         TIGR01364  78 aavplnllkekkvadyivtGawskkalkeakkltk..evkvvase.eekkyskipdeeelelkedaayvylcaneti 151
                                       +av  n+l ++ +a y+v+G+wsk a++eakkl    +++v++   + +  +k+     +    ++ y+++c net+
  lcl|FitnessBrowser__SB2B:6937577  81 SAVVNNFLGDNGKALYLVSGQWSKAATEEAKKLAGdnSIDVINVVeKVNGLNKVVIPALSGNGSEYRYLHYCPNETV 157
                                       *********************************9877444433332334445554446666668899********** PP

                         TIGR01364 152 eGvefkelpevkkaplvaDlssdilsrkidvskygliyaGaqKniGpaGvtvvivrkdllerakkelpsvldYkila 228
                                       +G+e+ +    +  p+vaD+ss+i+sr+idvs+++liyaGaqKniGp+G+++vivrkd+le  + + +s++dY+ +a
  lcl|FitnessBrowser__SB2B:6937577 158 DGIEIFDDI-DSPWPIVADMSSNIMSREIDVSRFALIYAGAQKNIGPSGLSIVIVRKDMLELPQLTQSSIMDYRLTA 233
                                       ******998.7889*************************************************************** PP

                         TIGR01364 229 endslyntpptfaiyvlglvlkwlkekGGvkklekknqeKakllYeaidesegfyknkvekkaRslmnvvFtlkkee 305
                                       ends+yntpptfa+y+++ v+kwlk+ GG+k +++ n eKa+ lY +id+  +fykn v++++Rs+mnv+F+l++e 
  lcl|FitnessBrowser__SB2B:6937577 234 ENDSMYNTPPTFAWYLAAEVFKWLKSVGGIKGMAEVNAEKARRLYACIDSL-DFYKNGVAPQNRSQMNVTFQLADES 309
                                       *************************************************77.6************************ PP

                         TIGR01364 306 lekeFlkeaeekglvslkGhrsvGGiRasiYnalpleevqaLvdfmkeFekkh 358
                                       l+k Flkeae+ glv+lkGhr+vGG+RasiYna+ple+v aLv+fm++F++kh
  lcl|FitnessBrowser__SB2B:6937577 310 LDKDFLKEAEALGLVALKGHRIVGGMRASIYNAMPLEGVDALVSFMRSFAAKH 362
                                       **************************************************997 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (358 nodes)
Target sequences:                          1  (364 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 8.89
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory