Align Histidinol-phosphate aminotransferase; Imidazole acetol-phosphate transaminase; HPAT; HspAT; EC 2.6.1.9 (characterized)
to candidate 6937802 Sama_1943 histidinol-phosphate aminotransferase (RefSeq)
Query= SwissProt::P06986 (356 letters) >FitnessBrowser__SB2B:6937802 Length = 362 Score = 260 bits (665), Expect = 3e-74 Identities = 158/350 (45%), Positives = 208/350 (59%), Gaps = 17/350 (4%) Query: 9 LARENVRNLTPYQSARRLGGNGDVWLNANEYPTAVEFQLTQ-QTLNRYPECQPKAVIENY 67 LAR + +L PYQSARR+GG+G++W+NANE P F T NRYPECQP +I Y Sbjct: 17 LARPELLSLEPYQSARRIGGSGEIWVNANESP----FNRTGIDGANRYPECQPPGLIAAY 72 Query: 68 AQYAGVKPEQVLVSRGADEGIELLIRAFCEPGKDAILYCPPTYGMYSVSAETIGVECRTV 127 A YAGV +++ RGADE IELLIR FC PG+D+I PTYGMY++SA T V T+ Sbjct: 73 AAYAGVAAHELVCGRGADEAIELLIRTFCVPGQDSIGIFSPTYGMYAISAATFNVAVNTL 132 Query: 128 PTLDNWQLDLQGISDKLDGVKVVYVCSPNNPTGQLINPQDFRTLLELTRGKAIVVADEAY 187 P +++ L IS L G K+V+VC+PNNPTG L+ P + T A+VV DEAY Sbjct: 133 PLAEDFSLP-DDIS-ALTGSKLVFVCNPNNPTGTLL-PLGEIARVAKTFPNALVVVDEAY 189 Query: 188 IEFC------PQASLAGWLAEYPHLAILRTLSKAFALAGLRCGFTLANEEVINLLMKVIA 241 IEF P S +AE+ +L ILRTLSKAF LAG RCGF LA V L+M+VIA Sbjct: 190 IEFAHNADGSPAQSATSLMAEFENLVILRTLSKAFGLAGARCGFLLAKPSVCELVMRVIA 249 Query: 242 PYPLSTPVADIAAQALSPQGIVAMRERVAQIIAEREYLIAALKEIPCVEQVFDSETNYIL 301 PYP+ PV+ IA +ALS GI MR V + + L AL E V S NY+L Sbjct: 250 PYPVPVPVSVIAEKALSVMGIAQMRADVVLLNKQGARLALALTEAGL--SVLPSGGNYVL 307 Query: 302 ARFKASSAVFKSLWDQGIILRDQNKQPSLSGCLRITVGTREESQRVIDAL 351 A + ++L GI+ R + P L +RI+ + +++ +I+A+ Sbjct: 308 AFSNDVEVLARALTKAGIVAR-RYSHPRLKDAIRISYASEQQTDSIIEAI 356 Lambda K H 0.319 0.135 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 343 Number of extensions: 21 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 356 Length of database: 362 Length adjustment: 29 Effective length of query: 327 Effective length of database: 333 Effective search space: 108891 Effective search space used: 108891 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate 6937802 Sama_1943 (histidinol-phosphate aminotransferase (RefSeq))
to HMM TIGR01141 (hisC: histidinol-phosphate transaminase (EC 2.6.1.9))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01141.hmm # target sequence database: /tmp/gapView.25017.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01141 [M=349] Accession: TIGR01141 Description: hisC: histidinol-phosphate transaminase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-93 299.0 0.0 2.2e-93 298.8 0.0 1.0 1 lcl|FitnessBrowser__SB2B:6937802 Sama_1943 histidinol-phosphate a Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__SB2B:6937802 Sama_1943 histidinol-phosphate aminotransferase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 298.8 0.0 2.2e-93 2.2e-93 1 348 [. 19 358 .. 19 359 .. 0.96 Alignments for each domain: == domain 1 score: 298.8 bits; conditional E-value: 2.2e-93 TIGR01141 1 rekikklepYqpgarelgekevvkLnsnEnPfgpsekvkealkeelkklhrYpdpqalelkealakylgveeenill 77 r+++ +lepYq+ ar++g+++ ++ n+nE+Pf+ + ++ +rYp++q+ l +a+a+y+gv + +++ lcl|FitnessBrowser__SB2B:6937802 19 RPELLSLEPYQS-ARRIGGSGEIWVNANESPFNRT---------GIDGANRYPECQPPGLIAAYAAYAGVAAHELVC 85 678999******.9*******************99.........46678**************************** PP TIGR01141 78 gnGsdelielliraflepg.davlvleptysmYevsakiagaevkevplkedgqedleavleaakekvklvflasPn 153 g+G+de+iellir+f+ pg d++ +++pty mY++sa++ ++ v + pl+ed+ ++++ a klvf+++Pn lcl|FitnessBrowser__SB2B:6937802 86 GRGADEAIELLIRTFCVPGqDSIGIFSPTYGMYAISAATFNVAVNTLPLAEDF-SLPDDIS--ALTGSKLVFVCNPN 159 *******************9********************************5.7888888..78999********* PP TIGR01141 154 nPtGnllkreeiekvleevedalVVvDeAYieFsee......asvlellaeypnlvvlrTlSKafgLAglRvGyaia 224 nPtG+ll ei +v+++ +alVVvDeAYieF+++ +s+++l+ae++nlv+lrTlSKafgLAg R+G+++a lcl|FitnessBrowser__SB2B:6937802 160 NPTGTLLPLGEIARVAKTFPNALVVVDEAYIEFAHNadgspaQSATSLMAEFENLVILRTLSKAFGLAGARCGFLLA 236 ******************999**************99999999********************************** PP TIGR01141 225 naeiiealekvrapynvsslaleaavaalrdsd..kiektveevkkererlleelkkleglevyeSkaNFvlikvke 299 ++++ e +++v+apy+v+++++ +a +al+ ++++ v ++k+ +rl +l++ gl+v +S +N+vl+ + lcl|FitnessBrowser__SB2B:6937802 237 KPSVCELVMRVIAPYPVPVPVSVIAEKALSVMGiaQMRADVVLLNKQGARLALALTEA-GLSVLPSGGNYVLAFSN- 311 *******************************998899999999**************9.8*************766. PP TIGR01141 300 daeelleallekgiivRdlksaeglleeclRitvGtreenerllealke 348 d e l++al+++gi+ R + ++ l++++Ri+ ++++++ ++ea+ + lcl|FitnessBrowser__SB2B:6937802 312 DVEVLARALTKAGIVARRYS--HPRLKDAIRISYASEQQTDSIIEAIGR 358 ******************99..5568*******************9986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (349 nodes) Target sequences: 1 (362 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 12.14 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory