Align ATP phosphoribosyltransferase; ATP-PRT; ATP-PRTase; EC 2.4.2.17 (characterized)
to candidate 6937800 Sama_1941 ATP phosphoribosyltransferase (RefSeq)
Query= SwissProt::P00499 (299 letters) >FitnessBrowser__SB2B:6937800 Length = 297 Score = 394 bits (1011), Expect = e-114 Identities = 196/293 (66%), Positives = 241/293 (82%) Query: 6 RLRIAIQKSGRLSDDSRELLARCGIKINLHTQRLIAMAENMPIDILRVRDDDIPGLVMDG 65 RLRIAIQKSGRLS +S++LL CG+K +++ QRLIA A+NMP+DILRVRDDDIPGLVMDG Sbjct: 4 RLRIAIQKSGRLSTESQQLLKSCGVKFSVNEQRLIAHADNMPVDILRVRDDDIPGLVMDG 63 Query: 66 VVDLGIIGENVLEEELLNRRAQGEDPRYLTLRRLDFGGCRLSLATPVDEAWDGPAALDGK 125 VVDLGI+GENVLEEE L R G + LR+LDFG CRLSLA P + + ++L+G Sbjct: 64 VVDLGIVGENVLEEEQLERDCLGNASDVVKLRQLDFGACRLSLAVPTEFVYGDASSLEGL 123 Query: 126 RIATSYPHLLKRYLDQKGVSFKSCLLNGSVEVAPRAGLADAICDLVSTGATLEANGLREV 185 RIATSYP+LL+R++ KG+S++ C L GSVEVAPRAGLAD ICDLVSTGATLEANGL E Sbjct: 124 RIATSYPNLLRRFMQNKGISYQDCQLKGSVEVAPRAGLADGICDLVSTGATLEANGLYET 183 Query: 186 EVIYRSKACLIQRDGEMAQSKQELIDKLLTRIQGVIQARESKYIMMHAPSERLEEVIALL 245 EVI+RS AC+IQ + +KQ LI+K+L+R+ GVI+ARESKYI++HAP+E LE+++ALL Sbjct: 184 EVIFRSMACIIQSTTPQSDTKQALINKILSRVNGVIRARESKYILLHAPTETLEQIVALL 243 Query: 246 PGAERPTILPLAGEQQRVAMHMVSSETLFWETMEKLKALGASSILVLPIEKMM 298 PGAE PT+LPL E RVA+H VS+E LFW+TME+L ALGASSILV+PIEKMM Sbjct: 244 PGAENPTVLPLNDETNRVAIHAVSTEDLFWDTMEELTALGASSILVMPIEKMM 296 Lambda K H 0.320 0.137 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 305 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 299 Length of database: 297 Length adjustment: 27 Effective length of query: 272 Effective length of database: 270 Effective search space: 73440 Effective search space used: 73440 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
Align candidate 6937800 Sama_1941 (ATP phosphoribosyltransferase (RefSeq))
to HMM TIGR00070 (hisG: ATP phosphoribosyltransferase (EC 2.4.2.17))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00070.hmm # target sequence database: /tmp/gapView.32140.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00070 [M=183] Accession: TIGR00070 Description: hisG: ATP phosphoribosyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-59 186.6 0.0 2.8e-59 186.1 0.0 1.2 1 lcl|FitnessBrowser__SB2B:6937800 Sama_1941 ATP phosphoribosyltran Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__SB2B:6937800 Sama_1941 ATP phosphoribosyltransferase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 186.1 0.0 2.8e-59 2.8e-59 1 183 [] 5 195 .. 5 195 .. 0.97 Alignments for each domain: == domain 1 score: 186.1 bits; conditional E-value: 2.8e-59 TIGR00070 1 lriAlp.KGrleeetlkllekaglklskkeerkliasaedeevevlllrakdiptyvekgaadlGitGkDlleEsea 76 lriA++ Grl+ e+ +ll+++g+k+s +e ++lia+a++ +v++l +r++dip v +g++dlGi+G+++leE++ lcl|FitnessBrowser__SB2B:6937800 5 LRIAIQkSGRLSTESQQLLKSCGVKFSVNE-QRLIAHADNMPVDILRVRDDDIPGLVMDGVVDLGIVGENVLEEEQL 80 89****99*********************9.99*****************************************666 PP TIGR00070 77 d.........vvelldlgfgkcklvlAvpeesdvesledlkegkriATkypnltreylekkgvkveivkleGavEla 144 + vv+l +l+fg+c+l+lAvp e + ++++l+ g riAT+ypnl r+++++kg++++ ++l+G+vE+a lcl|FitnessBrowser__SB2B:6937800 81 ErdclgnasdVVKLRQLDFGACRLSLAVPTEFVYGDASSLE-GLRIATSYPNLLRRFMQNKGISYQDCQLKGSVEVA 156 6677788888**********************999999999.99********************************* PP TIGR00070 145 pllgladaIvDivetGttLrengLkiieeilessarlia 183 p++glad I+D+v+tG+tL++ngL ++e+i++s a++i+ lcl|FitnessBrowser__SB2B:6937800 157 PRAGLADGICDLVSTGATLEANGLYETEVIFRSMACIIQ 195 ************************************995 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (183 nodes) Target sequences: 1 (297 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00 # Mc/sec: 7.94 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory