Align acetolactate synthase (subunit 1/2) (EC 2.2.1.6) (characterized)
to candidate 6937878 Sama_2019 acetolactate synthase 3 regulatory subunit (RefSeq)
Query= BRENDA::P00894 (163 letters) >FitnessBrowser__SB2B:6937878 Length = 164 Score = 228 bits (582), Expect = 3e-65 Identities = 114/163 (69%), Positives = 138/163 (84%) Query: 1 MRRILSVLLENESGALSRVIGLFSQRGYNIESLTVAPTDDPTLSRMTIQTVGDEKVLEQI 60 MRRI+SVLLEN+ GALSRV+GLFSQRGYNIE LTVAPTDD TLSRM I DE VLEQI Sbjct: 1 MRRIISVLLENQPGALSRVVGLFSQRGYNIECLTVAPTDDATLSRMNITVAADEMVLEQI 60 Query: 61 EKQLHKLVDVLRVSELGQGAHVEREIMLVKIQASGYGRDEVKRNTEIFRGQIIDVTPSLY 120 EKQLHKL+DVL+VS + + AH+ERE+ LVK++A R+E+KR+ +IFRGQI+DVT S Y Sbjct: 61 EKQLHKLIDVLKVSNITESAHIERELALVKVKAQSEVREEIKRSADIFRGQIVDVTASHY 120 Query: 121 TVQLAGTSGKLDAFLASIRDVAKIVEVARSGVVGLSRGDKIMR 163 T+QLAGT+ KLDAF+ ++ +V K+VEV+RSGVVGLSRGDK MR Sbjct: 121 TIQLAGTTEKLDAFINALAEVTKVVEVSRSGVVGLSRGDKSMR 163 Lambda K H 0.318 0.136 0.360 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 129 Number of extensions: 1 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 163 Length of database: 164 Length adjustment: 18 Effective length of query: 145 Effective length of database: 146 Effective search space: 21170 Effective search space used: 21170 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 43 (21.2 bits)
Align candidate 6937878 Sama_2019 (acetolactate synthase 3 regulatory subunit (RefSeq))
to HMM TIGR00119 (ilvN: acetolactate synthase, small subunit (EC 2.2.1.6))
../bin/blast/fastacmd -i /tmp/list.26996.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.26996.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.
For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.