Align succinyl-diaminopimelate desuccinylase (EC 3.5.1.18) (characterized)
to candidate 6937491 Sama_1647 succinyl-diaminopimelate desuccinylase (RefSeq)
Query= BRENDA::Q9KQ52 (377 letters) >FitnessBrowser__SB2B:6937491 Length = 382 Score = 541 bits (1395), Expect = e-159 Identities = 264/375 (70%), Positives = 301/375 (80%) Query: 2 TDSPVLALAKELISRQSVTPADAGCQDLMIERLKALGFEIESMVFEDTTNFWARRGTQSP 61 T S V+ L +ELISR SVTP D GCQDLM +RL A+GF IE MVFEDTTN WARRGT+ P Sbjct: 6 THSDVIELTRELISRPSVTPLDEGCQDLMAKRLAAIGFTIEPMVFEDTTNLWARRGTEGP 65 Query: 62 LFVFAGHTDVVPAGPLSQWHTPPFEPTVIDGFLHGRGAADMKGSLACMIVAVERFIAEHP 121 +F FAGHTDVVP G L++WHTPPF+P VIDG++HGRGAADMKGSLA M+VA ERF+AEHP Sbjct: 66 VFCFAGHTDVVPVGDLNRWHTPPFDPVVIDGYIHGRGAADMKGSLAAMVVAAERFVAEHP 125 Query: 122 DHQGSIGFLITSDEEGPFINGTVRVVETLMARNELIDMCIVGEPSSTLAVGDVVKNGRRG 181 DHQGSI FLITSDEEGPFINGTVRVVETL AR+E I +VGEPSST +GDVVKNGRRG Sbjct: 126 DHQGSIAFLITSDEEGPFINGTVRVVETLEARHEKITWALVGEPSSTHLLGDVVKNGRRG 185 Query: 182 SITGDLKVKGTQGHVAYPHLANNPVHKALPALAELAATQWDEGNAYFPPTSFQIPNLQAG 241 S+TG+L VKG QGHVAYPHLA+NP+H+A PALAEL+ +WD+GN +FPPTSFQI N+ G Sbjct: 186 SLTGNLTVKGIQGHVAYPHLADNPIHRAAPALAELSRIEWDKGNEFFPPTSFQIANINGG 245 Query: 242 TGASNVIPGEFDVQFNFRFSTELTDEEIKRRVHSVLDAHGLDYDVKWTLSGQPFLTDTGE 301 TGASNVIPGE V FNFR+STE+T E + RV +LDAHGLDYD+ W +G PFLT G Sbjct: 246 TGASNVIPGELKVMFNFRYSTEVTAETLIARVLGILDAHGLDYDIDWVFNGLPFLTGEGP 305 Query: 302 LLAAVVAAVEEVNHQAPALLTTGGTSDGRFIAQMGAQVVELGPVNATIHKVNECVRIADL 361 LL A A+ EV TTGGTSDGRFIA GAQV+ELGPVNATIHKVNECV+ +DL Sbjct: 306 LLDATREAIFEVTGTHTDPQTTGGTSDGRFIAPTGAQVIELGPVNATIHKVNECVKASDL 365 Query: 362 EKLTDMYQKTLNHLL 376 E LT YQ+ L LL Sbjct: 366 ELLTGCYQRILEKLL 380 Lambda K H 0.318 0.135 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 570 Number of extensions: 12 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 382 Length adjustment: 30 Effective length of query: 347 Effective length of database: 352 Effective search space: 122144 Effective search space used: 122144 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate 6937491 Sama_1647 (succinyl-diaminopimelate desuccinylase (RefSeq))
to HMM TIGR01246 (dapE: succinyl-diaminopimelate desuccinylase (EC 3.5.1.18))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01246.hmm # target sequence database: /tmp/gapView.25442.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01246 [M=370] Accession: TIGR01246 Description: dapE_proteo: succinyl-diaminopimelate desuccinylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.9e-175 568.1 0.0 4.5e-175 568.0 0.0 1.0 1 lcl|FitnessBrowser__SB2B:6937491 Sama_1647 succinyl-diaminopimela Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__SB2B:6937491 Sama_1647 succinyl-diaminopimelate desuccinylase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 568.0 0.0 4.5e-175 4.5e-175 2 370 .] 11 379 .. 10 379 .. 0.99 Alignments for each domain: == domain 1 score: 568.0 bits; conditional E-value: 4.5e-175 TIGR01246 2 lelakeLisrksvtPndagaqeliaerLkklgfeieilefedtknlwatrgteepvlvfaGhtDvvPaGelekWssd 78 +el++eLisr+svtP d+g+q+l+a+rL ++gf+ie + fedt+nlwa+rgte pv++faGhtDvvP+G+l++W+++ lcl|FitnessBrowser__SB2B:6937491 11 IELTRELISRPSVTPLDEGCQDLMAKRLAAIGFTIEPMVFEDTTNLWARRGTEGPVFCFAGHTDVVPVGDLNRWHTP 87 799************************************************************************** PP TIGR01246 79 pfepeerdGklygrGaaDmkgslaafvvaaerfvkknadhkGslsllitsDeegeaidGtkkvvetlkerdelidya 155 pf+p+++dG+++grGaaDmkgslaa+vvaaerfv++++dh+Gs+++litsDeeg +i+Gt++vvetl++r+e+i++a lcl|FitnessBrowser__SB2B:6937491 88 PFDPVVIDGYIHGRGAADMKGSLAAMVVAAERFVAEHPDHQGSIAFLITSDEEGPFINGTVRVVETLEARHEKITWA 164 ***************************************************************************** PP TIGR01246 156 vvgePssvkklGDvikiGrrGsitgklkikGiqGhvaYPhkaenPvhkavpvlkeliaiklDeGneffppsslqian 232 +vgePss++ lGDv+k+GrrGs+tg+l++kGiqGhvaYPh+a+nP+h+a+p+l+el i++D+Gneffpp+s+qian lcl|FitnessBrowser__SB2B:6937491 165 LVGEPSSTHLLGDVVKNGRRGSLTGNLTVKGIQGHVAYPHLADNPIHRAAPALAELSRIEWDKGNEFFPPTSFQIAN 241 ***************************************************************************** PP TIGR01246 233 ieagtgasnviPgelkvkfnlrfssevseeelkskvekildkhkldYelewklsgepfltkegklikkvaeaieevl 309 i++gtgasnviPgelkv+fn+r+s+ev++e+l +v ild+h+ldY+++w + g pflt eg l+++ +eai ev+ lcl|FitnessBrowser__SB2B:6937491 242 INGGTGASNVIPGELKVMFNFRYSTEVTAETLIARVLGILDAHGLDYDIDWVFNGLPFLTGEGPLLDATREAIFEVT 318 ***************************************************************************** PP TIGR01246 310 kkkpelstsGGtsDarfiaklgaevvelGlvndtihkvneavkiedleklsevyeklleel 370 +++++ +t+GGtsD+rfia ga+v+elG+vn+tihkvne+vk +dle l+ y+++le+l lcl|FitnessBrowser__SB2B:6937491 319 GTHTDPQTTGGTSDGRFIAPTGAQVIELGPVNATIHKVNECVKASDLELLTGCYQRILEKL 379 **********************************************************986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (370 nodes) Target sequences: 1 (382 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 8.74 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory