Align succinyl-diaminopimelate desuccinylase (EC 3.5.1.18) (characterized)
to candidate 6937491 Sama_1647 succinyl-diaminopimelate desuccinylase (RefSeq)
Query= BRENDA::Q9KQ52 (377 letters) >FitnessBrowser__SB2B:6937491 Length = 382 Score = 541 bits (1395), Expect = e-159 Identities = 264/375 (70%), Positives = 301/375 (80%) Query: 2 TDSPVLALAKELISRQSVTPADAGCQDLMIERLKALGFEIESMVFEDTTNFWARRGTQSP 61 T S V+ L +ELISR SVTP D GCQDLM +RL A+GF IE MVFEDTTN WARRGT+ P Sbjct: 6 THSDVIELTRELISRPSVTPLDEGCQDLMAKRLAAIGFTIEPMVFEDTTNLWARRGTEGP 65 Query: 62 LFVFAGHTDVVPAGPLSQWHTPPFEPTVIDGFLHGRGAADMKGSLACMIVAVERFIAEHP 121 +F FAGHTDVVP G L++WHTPPF+P VIDG++HGRGAADMKGSLA M+VA ERF+AEHP Sbjct: 66 VFCFAGHTDVVPVGDLNRWHTPPFDPVVIDGYIHGRGAADMKGSLAAMVVAAERFVAEHP 125 Query: 122 DHQGSIGFLITSDEEGPFINGTVRVVETLMARNELIDMCIVGEPSSTLAVGDVVKNGRRG 181 DHQGSI FLITSDEEGPFINGTVRVVETL AR+E I +VGEPSST +GDVVKNGRRG Sbjct: 126 DHQGSIAFLITSDEEGPFINGTVRVVETLEARHEKITWALVGEPSSTHLLGDVVKNGRRG 185 Query: 182 SITGDLKVKGTQGHVAYPHLANNPVHKALPALAELAATQWDEGNAYFPPTSFQIPNLQAG 241 S+TG+L VKG QGHVAYPHLA+NP+H+A PALAEL+ +WD+GN +FPPTSFQI N+ G Sbjct: 186 SLTGNLTVKGIQGHVAYPHLADNPIHRAAPALAELSRIEWDKGNEFFPPTSFQIANINGG 245 Query: 242 TGASNVIPGEFDVQFNFRFSTELTDEEIKRRVHSVLDAHGLDYDVKWTLSGQPFLTDTGE 301 TGASNVIPGE V FNFR+STE+T E + RV +LDAHGLDYD+ W +G PFLT G Sbjct: 246 TGASNVIPGELKVMFNFRYSTEVTAETLIARVLGILDAHGLDYDIDWVFNGLPFLTGEGP 305 Query: 302 LLAAVVAAVEEVNHQAPALLTTGGTSDGRFIAQMGAQVVELGPVNATIHKVNECVRIADL 361 LL A A+ EV TTGGTSDGRFIA GAQV+ELGPVNATIHKVNECV+ +DL Sbjct: 306 LLDATREAIFEVTGTHTDPQTTGGTSDGRFIAPTGAQVIELGPVNATIHKVNECVKASDL 365 Query: 362 EKLTDMYQKTLNHLL 376 E LT YQ+ L LL Sbjct: 366 ELLTGCYQRILEKLL 380 Lambda K H 0.318 0.135 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 570 Number of extensions: 12 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 382 Length adjustment: 30 Effective length of query: 347 Effective length of database: 352 Effective search space: 122144 Effective search space used: 122144 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate 6937491 Sama_1647 (succinyl-diaminopimelate desuccinylase (RefSeq))
to HMM TIGR01246 (dapE: succinyl-diaminopimelate desuccinylase (EC 3.5.1.18))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01246.hmm # target sequence database: /tmp/gapView.30671.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01246 [M=370] Accession: TIGR01246 Description: dapE_proteo: succinyl-diaminopimelate desuccinylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.9e-175 568.1 0.0 4.5e-175 568.0 0.0 1.0 1 lcl|FitnessBrowser__SB2B:6937491 Sama_1647 succinyl-diaminopimela Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__SB2B:6937491 Sama_1647 succinyl-diaminopimelate desuccinylase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 568.0 0.0 4.5e-175 4.5e-175 2 370 .] 11 379 .. 10 379 .. 0.99 Alignments for each domain: == domain 1 score: 568.0 bits; conditional E-value: 4.5e-175 TIGR01246 2 lelakeLisrksvtPndagaqeliaerLkklgfeieilefedtknlwatrgteepvlvfaGhtDvvPaGelekWssd 78 +el++eLisr+svtP d+g+q+l+a+rL ++gf+ie + fedt+nlwa+rgte pv++faGhtDvvP+G+l++W+++ lcl|FitnessBrowser__SB2B:6937491 11 IELTRELISRPSVTPLDEGCQDLMAKRLAAIGFTIEPMVFEDTTNLWARRGTEGPVFCFAGHTDVVPVGDLNRWHTP 87 799************************************************************************** PP TIGR01246 79 pfepeerdGklygrGaaDmkgslaafvvaaerfvkknadhkGslsllitsDeegeaidGtkkvvetlkerdelidya 155 pf+p+++dG+++grGaaDmkgslaa+vvaaerfv++++dh+Gs+++litsDeeg +i+Gt++vvetl++r+e+i++a lcl|FitnessBrowser__SB2B:6937491 88 PFDPVVIDGYIHGRGAADMKGSLAAMVVAAERFVAEHPDHQGSIAFLITSDEEGPFINGTVRVVETLEARHEKITWA 164 ***************************************************************************** PP TIGR01246 156 vvgePssvkklGDvikiGrrGsitgklkikGiqGhvaYPhkaenPvhkavpvlkeliaiklDeGneffppsslqian 232 +vgePss++ lGDv+k+GrrGs+tg+l++kGiqGhvaYPh+a+nP+h+a+p+l+el i++D+Gneffpp+s+qian lcl|FitnessBrowser__SB2B:6937491 165 LVGEPSSTHLLGDVVKNGRRGSLTGNLTVKGIQGHVAYPHLADNPIHRAAPALAELSRIEWDKGNEFFPPTSFQIAN 241 ***************************************************************************** PP TIGR01246 233 ieagtgasnviPgelkvkfnlrfssevseeelkskvekildkhkldYelewklsgepfltkegklikkvaeaieevl 309 i++gtgasnviPgelkv+fn+r+s+ev++e+l +v ild+h+ldY+++w + g pflt eg l+++ +eai ev+ lcl|FitnessBrowser__SB2B:6937491 242 INGGTGASNVIPGELKVMFNFRYSTEVTAETLIARVLGILDAHGLDYDIDWVFNGLPFLTGEGPLLDATREAIFEVT 318 ***************************************************************************** PP TIGR01246 310 kkkpelstsGGtsDarfiaklgaevvelGlvndtihkvneavkiedleklsevyeklleel 370 +++++ +t+GGtsD+rfia ga+v+elG+vn+tihkvne+vk +dle l+ y+++le+l lcl|FitnessBrowser__SB2B:6937491 319 GTHTDPQTTGGTSDGRFIAPTGAQVIELGPVNATIHKVNECVKASDLELLTGCYQRILEKL 379 **********************************************************986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (370 nodes) Target sequences: 1 (382 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.87 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory