Align candidate 6936570 Sama_0758 (B12-dependent methionine synthase (RefSeq))
to HMM PF02965 (Met_synt_B12)
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/PF02965.21.hmm # target sequence database: /tmp/gapView.18417.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: Met_synt_B12 [M=273] Accession: PF02965.21 Description: Vitamin B12 dependent methionine synthase, activation domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-132 426.9 0.0 3.1e-132 426.1 0.0 1.4 1 lcl|FitnessBrowser__SB2B:6936570 Sama_0758 B12-dependent methioni Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__SB2B:6936570 Sama_0758 B12-dependent methionine synthase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 426.1 0.0 3.1e-132 3.1e-132 2 273 .] 956 1227 .. 955 1227 .. 0.99 Alignments for each domain: == domain 1 score: 426.1 bits; conditional E-value: 3.1e-132 Met_synt_B12 2 leelveyidWtpffqaWelkgkypkiledekvgeeakklfkdAqamLkkiieekllkakavvglfpAnse.gddi 75 l++lv+ idWtpff+aWel+g++p+ilede+vgeea+klf+dA+amL++ii+ek+l+ak+v+glfpAn++ +ddi lcl|FitnessBrowser__SB2B:6936570 956 LDDLVDRIDWTPFFRAWELHGHFPRILEDEVVGEEARKLFADAKAMLQTIIDEKWLTAKGVIGLFPANTVnHDDI 1030 899******************************************************************955*** PP Met_synt_B12 76 evyadesrseelatlhtLrqqaekeegkpnlclaDfvapkesgvkDyiGlFavtaglgieelakefeaekddYsa 150 e+y+desrs++l+t h+Lr q e+ g++n+cl+Dfvapk+sgv Dy G+Fav+ag+gi+e++++fea++ddY+a lcl|FitnessBrowser__SB2B:6936570 1031 ELYTDESRSQVLMTTHHLRMQIER-VGNDNFCLSDFVAPKDSGVVDYTGGFAVCAGHGIDEHLARFEANHDDYNA 1104 *********************987.799*********************************************** PP Met_synt_B12 151 ilvkaladrLaeAfaellhekvrkelWgyakdeklsneelikekYqgiRpApGYpacpdhtekktlfelldaeek 225 i++k ladrLaeAfae++he+vrke+Wgya+de+l+ne+li+ekY+giRpApGYpacpdhtek l++ll+ +e lcl|FitnessBrowser__SB2B:6936570 1105 IMLKVLADRLAEAFAERMHERVRKEFWGYASDENLDNEALIREKYRGIRPAPGYPACPDHTEKGLLWDLLKPNEC 1179 *************************************************************************** PP Met_synt_B12 226 igieLteslamtPaasvsGlyfahpearyFavgkiekdqvedyakrkg 273 i++++tes+am+P+a+vsG+yfahpearyF+v +i++dqvedya+rkg lcl|FitnessBrowser__SB2B:6936570 1180 IDLNITESFAMYPTAAVSGWYFAHPEARYFGVTNIGRDQVEDYARRKG 1227 **********************************************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (273 nodes) Target sequences: 1 (1246 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 26.31 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory