Align Ornithine aminotransferase 1; OAT 1; EC 2.6.1.13; Ornithine--oxo-acid aminotransferase 1 (uncharacterized)
to candidate 6937472 Sama_1628 bifunctional N-succinyldiaminopimelate-aminotransferase/acetylornithine transaminase protein (RefSeq)
Query= curated2:Q4A0N2 (394 letters) >FitnessBrowser__SB2B:6937472 Length = 405 Score = 260 bits (665), Expect = 4e-74 Identities = 143/386 (37%), Positives = 222/386 (57%), Gaps = 19/386 (4%) Query: 9 DKYSSKNYSPLKLALAKGRGAKVWDIEDNCYIDCISGFSVVNQGHCHPKIIKALQEQSQR 68 D+ NY+P + KG G+++WD + +ID G +V GHCHP ++ AL EQ+Q+ Sbjct: 9 DEVMVPNYAPSPIIPVKGLGSRLWDQQGREFIDFAGGIAVNCLGHCHPALVSALTEQAQK 68 Query: 69 ITMVSRALYSDNLGKWEEKICKLANKENVLPMNTGTEAVETAIKMAR-----KWGADIKN 123 + +S + ++ + + E V N+G EA E A+K+ R K+GAD Sbjct: 69 LWHLSNTMTNEPALMLAKHLVDNTFAEKVYFANSGAEANEAALKLVRRVALNKFGAD--- 125 Query: 124 IDESSSEIIAMNGNFHGRTLGSLSLSSQDSYKKGFGPLLNNIHYADFGDIEQLKKLINNQ 183 S+IIA FHGRTL ++S+ Q +Y GFGP +I +A++ +++ LK LI+++ Sbjct: 126 ----KSQIIAFKQGFHGRTLFTVSVGGQPAYSDGFGPKPADIDHAEYNNLDSLKALISDR 181 Query: 184 TTAIILEPIQGEGGVNIPPTHFIQEVRQLCNEYNVLLIADEIQVGLGRTGKMFAMEWENT 243 T A++LEP+QGEGG+ P FI+ VR+LC+++N LL+ DE+Q G+GRTG+++A Sbjct: 182 TCAVVLEPLQGEGGIINPTPEFIKGVRELCDQHNALLVFDEVQTGVGRTGELYAYMGLGV 241 Query: 244 EPDIYLLGKSLGGGLYPISAVLANQDVMSVLTPGTHGSTFGGNPLACAVSMAALDVLNEE 303 PD+ K+LGGG +PI A+L ++ L GTHGST+GGNPLACAV +AA +N Sbjct: 242 TPDVLTTAKALGGG-FPIGAMLTTTELAKHLVVGTHGSTYGGNPLACAVGLAAFTTVNTP 300 Query: 304 HLVQNALDLGDRLLKHLQQIES--ELIVEVRGRGLFIGIELNV----AAQDYCEQMINKG 357 ++ + L I ++ EVRG+GL +G LN A+D+ +G Sbjct: 301 EVLNGVKEREQLFRDGLNAINDKYQVFTEVRGKGLLLGAALNADYAGKARDFMLAAAEEG 360 Query: 358 VLCKETQGNIIRIAPPLVIDKDEIDE 383 VL N++R AP L+I + ++ E Sbjct: 361 VLLLMAGQNVVRFAPSLIIPEADVRE 386 Lambda K H 0.317 0.136 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 369 Number of extensions: 14 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 394 Length of database: 405 Length adjustment: 31 Effective length of query: 363 Effective length of database: 374 Effective search space: 135762 Effective search space used: 135762 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory