Align Ornithine aminotransferase; Orn-AT; Lysine aminotransferase; Lys-AT; EC 2.6.1.13; EC 2.6.1.36 (characterized)
to candidate 6938540 Sama_2643 putative aminotransferase (RefSeq)
Query= SwissProt::Q5JEW1 (445 letters) >FitnessBrowser__SB2B:6938540 Length = 460 Score = 193 bits (490), Expect = 1e-53 Identities = 136/429 (31%), Positives = 224/429 (52%), Gaps = 34/429 (7%) Query: 39 VIERGEGIRVYDVDGNVFYDFASGVGVINVGHSHPRVVEAIKKQAEKFTHYSLTDFF--- 95 VIER EG+ ++D GN D +G+ +NVG+ + +A Q + Y+ +FF Sbjct: 37 VIERAEGVYIWDAKGNKLLDAMAGLWCVNVGYGRKSIADAAYAQLQTLPFYN--NFFQCT 94 Query: 96 YENAIILAEKLIELAPGDIERKVVYGNSGAEANEAAMKLV------KYGTGRKQFLAFYH 149 +E AI LA K+ LAPG + R V + SG+EAN+ +++V K +K ++ + Sbjct: 95 HEPAIRLASKIASLAPGHMNR-VFFTGSGSEANDTNLRMVRRYWDLKGMPSKKTIISRKN 153 Query: 150 AFHGRTQAVLSLTASKWVQQDGFFPTMPGVTHIPYPNPYRNTWGIDGYE-EPDELTNRVL 208 A+HG T A SL ++ Q G P +PG+ HI P W +G + P+ + Sbjct: 154 AYHGSTVAGASLGGMGFMHQQGDLP-IPGIVHIDQPY-----WFGEGRDMSPEAFGIKTA 207 Query: 209 DFIEEYVFRHVPPHEIGAIFFEPIQGEGGYVVPPKGFFKALKKFADEYGILLADDEVQMG 268 +E + + ++ A EP QG GG ++PP ++ +K+ ++Y IL DEV G Sbjct: 208 QALEAKILE-LGEDKVAAFIAEPFQGAGGVIIPPDSYWNEIKRILEKYNILFILDEVISG 266 Query: 269 IGRTGKFWAIEHFGVEPDLIQFGKAIGGG-LPLAGVI---HRADITFDKPGR--HATTFG 322 GRTG ++A + G++PDLI K + G +P+ GVI AD+ G H T+ Sbjct: 267 FGRTGNWFAAQTLGLKPDLITIAKGMTSGYIPMGGVIVSDRVADVLISDGGEFAHGFTYS 326 Query: 323 GNPVAIAAGIEVVEIVKE--LLPHVQ-EVGDYLHKYLEEFKEKYEVIGDARGLGLAQAVE 379 G+PVA A +E + I++E L+ V+ + G YL L+ + ++G+ RG+G+ A+E Sbjct: 327 GHPVAAAVALENIRILEEERLVDKVRTDTGPYLQDRLQTL-SAHPLVGEVRGMGMVGAIE 385 Query: 380 IVKSKETKEKY-PELRDRIVKESA--KRGLVLLGCGDNSIRFIPPLIVTKEEIDVAMEIF 436 +V K + ++ E+ ++ A + GLV+ GD I PPL +T++EID + Sbjct: 386 LVADKHSMVRFGSEISAGMLCREACIESGLVMRAVGDTMI-ISPPLCITRDEIDELIFKA 444 Query: 437 EEALKAALK 445 +AL L+ Sbjct: 445 SQALSLTLE 453 Lambda K H 0.320 0.141 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 475 Number of extensions: 30 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 445 Length of database: 460 Length adjustment: 33 Effective length of query: 412 Effective length of database: 427 Effective search space: 175924 Effective search space used: 175924 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory