Align Putative [LysW]-L-2-aminoadipate/[LysW]-L-glutamate phosphate reductase; EC 1.2.1.- (uncharacterized)
to candidate 6936059 Sama_0256 N-acetyl-gamma-glutamyl-phosphate reductase (RefSeq)
Query= curated2:Q9YBY8 (355 letters) >FitnessBrowser__SB2B:6936059 Length = 331 Score = 158 bits (399), Expect = 2e-43 Identities = 111/342 (32%), Positives = 169/342 (49%), Gaps = 25/342 (7%) Query: 6 RAGILGASGMTGGELLRILASHPGVEVEWATSREYA---GKPVHTAHP---HLRGFYTGL 59 + I+GASG TG +L ++ + P ++V+ E + GKP+ + +P HL+ + L Sbjct: 8 KIAIIGASGYTGAQLTALIDAEPHLQVQGLYVSEGSADKGKPLSSLYPVYSHLKYCLSPL 67 Query: 60 KYTSIDKIDIGEVDVVFNALPHGVGASIVAEAYENGVRVVDLSADYRLRDQSLYPKLYGF 119 + D I + E D V A H V + A YE G+ V DLS YR D + YPK YGF Sbjct: 68 TDEAKDAI-VAEADAVALATEHSVSLELAAYFYEKGLAVFDLSGAYRFADTAQYPKWYGF 126 Query: 120 KHPRPDLLEEAIYALPEIYGEKLRGARLAAVPGCNATAAILAAAPLVASKIIDMDVGIIV 179 +H P++L +A+Y L E + + R+ AVPGC TA++ A PL K + + ++ Sbjct: 127 EHSHPEVLAKAVYGLAEWNADAVAATRMIAVPGCYPTASLTALKPL---KAMLTEARPVI 183 Query: 180 DVKAASSEAGSKPSRHSIHPLREGSARPYTPWGHRHAAEAVQVLRDLVGRGIRLSLVPHA 239 + + + AG K H+ E S PY GHRH E L G + PH Sbjct: 184 NAVSGVTGAGRKAQLHT--SFCEVSLTPYGVLGHRHQPEIATQL------GQEVIFTPHL 235 Query: 240 VSMTRGVLASAHALLRDNIGFSEAVRAYASFYKDSQIVRVKPMAPGLPVDPPDVKNVIGS 299 + RG+LA+ L+ + +AY S Y S IV VK P V +V+ + Sbjct: 236 GNFKRGILATITVQLKPGTSREDVAKAY-SVYDQSPIVTVK------EGQFPKVDDVVFT 288 Query: 300 MFAEVGFAVEEESGRITGFAAIDNLVRGAAGQAVYAMNAMLG 341 +G+ +E+SG + +AIDNL++GAA QA+ + G Sbjct: 289 PNCHLGWKFDEDSGYLVVASAIDNLMKGAASQALQCIKIHFG 330 Lambda K H 0.319 0.136 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 284 Number of extensions: 19 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 355 Length of database: 331 Length adjustment: 29 Effective length of query: 326 Effective length of database: 302 Effective search space: 98452 Effective search space used: 98452 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory