Align homoserine kinase; EC 2.7.1.39 (characterized)
to candidate 6936719 Sama_0906 homoserine kinase (RefSeq)
Query= CharProtDB::CH_002113 (310 letters) >FitnessBrowser__SB2B:6936719 Length = 314 Score = 348 bits (892), Expect = e-100 Identities = 172/307 (56%), Positives = 226/307 (73%), Gaps = 3/307 (0%) Query: 4 VYAPASSANMSVGFDVLGAAVTPVDGALLGD-VVTVEAAETFSLNNLGRFADKLPSEPRE 62 VYAPAS N+ VGFD+LGAA+ P++G+LLGD V+ EA +LN G +A KLP+ PRE Sbjct: 5 VYAPASMGNVGVGFDLLGAALAPIEGSLLGDRVMIAEANAGLTLNTTGAWAHKLPANPRE 64 Query: 63 NIVYQCWERFCQELGKQ-IPVAMTLEKNMPIGSGLGSSACSVVAALMAMNEHCGKPLNDT 121 NIV+QC E F Q LGK+ + +A+TLEKN+P+GSGLGSSA SVVAAL A+NE+ KP ++ Sbjct: 65 NIVWQCAEFFLQRLGKEELGIALTLEKNLPVGSGLGSSASSVVAALYALNEYFDKPFDEQ 124 Query: 122 RLLALMGELEGRISGSIHYDNVAPCFLGGMQLMIEENDIISQQVPGFDEWLWVLAYPGIK 181 LLALMGE EG+ISGS+HYDNVAPC+LGGMQLM++ I + +P F+ W WV+AYPGI Sbjct: 125 ALLALMGEFEGKISGSVHYDNVAPCYLGGMQLMLDLPGRICESIPSFEHWYWVVAYPGIS 184 Query: 182 VSTAEARAILPAQYRRQDCIAHGRHLAGFIHACYSRQPELAAKLMKDVIAEPYRERLLPG 241 +STA+ RA++P Y + I GRHL+ F+HA Y + LA ++KDV+AEPYR +PG Sbjct: 185 LSTAKMRALMPDSYDKSVVIDFGRHLSAFVHASYRQDEALALAVLKDVLAEPYRAPAIPG 244 Query: 242 FRQARQAVAEIGAVASGISGSGPTLFALCDKPETAQRVADWLGKNYLQNQEGFVHICRLD 301 + +AR A+AE+G + SGISGSGPTLF++ ETA+ WL +YL + GF H+CRLD Sbjct: 245 YLEARDALAELGMLTSGISGSGPTLFSVTSCLETAEAAKAWLEAHYL-TEGGFAHVCRLD 303 Query: 302 TAGARVL 308 G RV+ Sbjct: 304 MQGTRVV 310 Lambda K H 0.321 0.136 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 314 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 310 Length of database: 314 Length adjustment: 27 Effective length of query: 283 Effective length of database: 287 Effective search space: 81221 Effective search space used: 81221 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
Align candidate 6936719 Sama_0906 (homoserine kinase (RefSeq))
to HMM TIGR00191 (thrB: homoserine kinase (EC 2.7.1.39))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00191.hmm # target sequence database: /tmp/gapView.25636.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00191 [M=304] Accession: TIGR00191 Description: thrB: homoserine kinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.6e-88 281.3 0.0 4.1e-88 281.1 0.0 1.0 1 lcl|FitnessBrowser__SB2B:6936719 Sama_0906 homoserine kinase (Ref Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__SB2B:6936719 Sama_0906 homoserine kinase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 281.1 0.0 4.1e-88 4.1e-88 1 302 [. 3 310 .. 3 312 .. 0.96 Alignments for each domain: == domain 1 score: 281.1 bits; conditional E-value: 4.1e-88 TIGR00191 1 lkvkvPassANlgpGfDvlGlalslvlellvtedvaqeskdk..sleaegegvekipkesdkNliyqvakkvlkklg 75 l+v++Pas N+g+GfD lG+al +++++l+++ v ++++++ l+++g ++k+p+++++N++ q+a+ +l++lg lcl|FitnessBrowser__SB2B:6936719 3 LTVYAPASMGNVGVGFDLLGAALAPIEGSLLGDRVMIAEANAglTLNTTGAWAHKLPANPRENIVWQCAEFFLQRLG 79 68*******************************99777777767899999999************************ PP TIGR00191 76 krvkpvkltvekeiplgrGLGSSaaaivaaviaanelaglklskeelldlalllEg......HpDNvapallGGlql 146 k+ +++lt+ek++p+g+GLGSSa+++vaa++a+ne ++++++++ ll+l+++ Eg H+DNvap++lGG+ql lcl|FitnessBrowser__SB2B:6936719 80 KEELGIALTLEKNLPVGSGLGSSASSVVAALYALNEYFDKPFDEQALLALMGEFEGkisgsvHYDNVAPCYLGGMQL 156 ***************************************************************************** PP TIGR00191 147 avkeddllevlkvPsgsklkvvlviPnievsTaeaRavLPkaysrqdlvfnlshlavlvtAlvskdkadllaiamkD 223 ++ ++ ++Ps++++++v+++P+i++sTa+ Ra++P +y+ + ++ ++hl+ +v+A + + + l+ ++kD lcl|FitnessBrowser__SB2B:6936719 157 MLDLPG-RICESIPSFEHWYWVVAYPGISLSTAKMRALMPDSYDKSVVIDFGRHLSAFVHASYRQ-DEALALAVLKD 231 **9999.9*********************************************************.778888999** PP TIGR00191 224 rvhqpyRekliPelteikqaakekgalgitlSGaGptilalaeeek.eekaqelleklakegieltvkvleldtdga 299 ++++pyR+ iP++ e + a +e g+l++++SG+Gpt++++++ + +e a+ +le ++ + ++ +v++ld++g+ lcl|FitnessBrowser__SB2B:6936719 232 VLAEPYRAPAIPGYLEARDALAELGMLTSGISGSGPTLFSVTSCLEtAEAAKAWLEAHYLT-EGGFAHVCRLDMQGT 307 *******************************************999888999999988875.67899********** PP TIGR00191 300 eve 302 +v+ lcl|FitnessBrowser__SB2B:6936719 308 RVV 310 997 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (304 nodes) Target sequences: 1 (314 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 8.44 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory