Align Phosphoribosyl isomerase A; 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; EC 5.3.1.16; N-(5'-phosphoribosyl)anthranilate isomerase; PRAI; EC 5.3.1.24; Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase (uncharacterized)
to candidate 6937805 Sama_1946 1-(5-phosphoribosyl)-5-[(5- phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase (RefSeq)
Query= curated2:P60583 (243 letters) >FitnessBrowser__SB2B:6937805 Length = 245 Score = 139 bits (351), Expect = 4e-38 Identities = 86/243 (35%), Positives = 139/243 (57%), Gaps = 9/243 (3%) Query: 3 ILLPAVDVVDGRAVRLVQGKAGSETEYG-SALDAALGWQRDGAEWIHLVDLDAAFGRGSN 61 +++PA+D++DG+ VRL QG +TE+ + L +Q+DGA +HLVDL A Sbjct: 1 MIIPAIDLIDGQVVRLFQGDYAKKTEFSLDPKNQLLSYQQDGAALLHLVDLTGAKDPDKR 60 Query: 62 R-ELLAEVVGKLDVRVELSGGIRDDDSLAAALATGCARVNLGTAALENPQWCARAIGEH- 119 + +L+ E+ L +++ GGIR + A L G ARV +G+ A+++P+ R ++ Sbjct: 61 QTKLIEEIAASLSTPLQVGGGIRSAADVDALLNAGVARVVIGSLAVKSPEVVLRLFDKYG 120 Query: 120 GDKVAVGLDVQI-IDGQHRLRGRGWETDGG-DLWEVLERLERQGCSRYVVTDVTKDGTLG 177 GD + + LDV I DG + GW+ GG L +++ G +VTD+++DGT+ Sbjct: 121 GDAICLALDVNIDADGNKMVAVHGWQQGGGKSLESLVDTFMPAGLKHALVTDISRDGTMT 180 Query: 178 GPNLDLLGAVADR-TDAPVIASGGVSSLDDLRAIATLTGRGVEGAIVGKALYAGRFTLPQ 236 G N L +A+R + ASGGV++LDD++A+ T G G I+GKAL G F+ + Sbjct: 181 GANTALYCELAERFNEVQWQASGGVATLDDVKAVKT---SGASGIIIGKALLTGVFSAKE 237 Query: 237 ALA 239 A+A Sbjct: 238 AIA 240 Lambda K H 0.318 0.138 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 204 Number of extensions: 16 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 243 Length of database: 245 Length adjustment: 24 Effective length of query: 219 Effective length of database: 221 Effective search space: 48399 Effective search space used: 48399 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory