Align Aminodeoxychorismate/anthranilate synthase component 2; ADC synthase; ADCS; 4-amino-4-deoxychorismate synthase component 2; Aminodeoxychorismate synthase, glutamine amidotransferase component; EC 2.6.1.85; EC 4.1.3.27 (characterized)
to candidate 6938912 Sama_3015 para-aminobenzoate synthase glutamine amidotransferase, component II (RefSeq)
Query= SwissProt::P28819 (194 letters) >FitnessBrowser__SB2B:6938912 Length = 216 Score = 244 bits (623), Expect = 8e-70 Identities = 118/190 (62%), Positives = 151/190 (79%), Gaps = 6/190 (3%) Query: 1 MILMIDNYDSFTYNLVQYLGELGEELVVKRNDSITIDEIEELSPDFLMISPGPCSPDEAG 60 M+LMIDNYDSFT+NLVQY +LGEE+VV+R+D IT++EI L+PD+L+ISPGPC+PD+AG Sbjct: 26 MLLMIDNYDSFTFNLVQYFQQLGEEVVVRRHDDITLEEIAALAPDYLVISPGPCTPDDAG 85 Query: 61 ISLEAIKHFAGKIPIFGVCLGHQSIAQVFGGDVVRAERLMHGKTSDIEHDGKTIFEGLKN 120 +SL+AI HFAGK+PI GVCLGHQ++AQVFG V+RA R+MHGKTSDI H+ + +F GL N Sbjct: 86 VSLDAITHFAGKLPILGVCLGHQAMAQVFGAKVIRAGRVMHGKTSDISHNNQRLFRGLNN 145 Query: 121 PLVATRYHSLIVKPETLPSCFTVTAQTKE----GEIMAIRHNDLPIEGVQFHPESIMTSF 176 PL TRYHSL+V E++P F + A + EIMAI H LP+ GVQFHPESI+T Sbjct: 146 PLRVTRYHSLLV--ESVPEGFVMDAWFDDPVHGREIMAISHKSLPLYGVQFHPESILTEQ 203 Query: 177 GKEMLRNFIE 186 G E+L NF++ Sbjct: 204 GLELLGNFLK 213 Lambda K H 0.320 0.139 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 171 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 194 Length of database: 216 Length adjustment: 21 Effective length of query: 173 Effective length of database: 195 Effective search space: 33735 Effective search space used: 33735 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 45 (21.9 bits)
Align candidate 6938912 Sama_3015 (para-aminobenzoate synthase glutamine amidotransferase, component II (RefSeq))
to HMM TIGR00566 (glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase)
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00566.hmm # target sequence database: /tmp/gapView.30192.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00566 [M=192] Accession: TIGR00566 Description: trpG_papA: glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.5e-84 267.4 0.0 4e-84 267.2 0.0 1.0 1 lcl|FitnessBrowser__SB2B:6938912 Sama_3015 para-aminobenzoate syn Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__SB2B:6938912 Sama_3015 para-aminobenzoate synthase glutamine amidotransferase, component II (Ref # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 267.2 0.0 4e-84 4e-84 1 191 [. 26 213 .. 26 214 .. 0.97 Alignments for each domain: == domain 1 score: 267.2 bits; conditional E-value: 4e-84 TIGR00566 1 mvllidnydsftynlvqlleelgaevvvkrndsltlqeieallpllsivisPGPctPdeaaissleliehlaGklPi 77 m+l+idnydsft+nlvq++++lg+evvv+r d++tl+ei al+p+ +visPGPctPd+a++s l++i h+aGklPi lcl|FitnessBrowser__SB2B:6938912 26 MLLMIDNYDSFTFNLVQYFQQLGEEVVVRRHDDITLEEIAALAPDY-LVISPGPCTPDDAGVS-LDAITHFAGKLPI 100 79********************************************.****************.************* PP TIGR00566 78 lGvClGhqalaqafGadvvraekvkhGkvseiehngaavfaglfnPdalkatryhslvveaetldtllevtaleeee 154 lGvClGhqa+aq+fGa+v+ra +v+hGk+s+i+hn++ +f+gl nP l++tryhsl ve ++++ + + a+ + + lcl|FitnessBrowser__SB2B:6938912 101 LGVCLGHQAMAQVFGAKVIRAGRVMHGKTSDISHNNQRLFRGLNNP--LRVTRYHSLLVE--SVPEGFVMDAWFDDP 173 **********************************************..**********96..699999999998877 PP TIGR00566 155 ...ieimairhrdlpleGvqfhPesilselGkellanflk 191 eimai h+ lpl GvqfhPesil+e+G ell nflk lcl|FitnessBrowser__SB2B:6938912 174 vhgREIMAISHKSLPLYGVQFHPESILTEQGLELLGNFLK 213 7789**********************************98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (192 nodes) Target sequences: 1 (216 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 6.97 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory