Align Anthranilate phosphoribosyltransferase; EC 2.4.2.18 (characterized)
to candidate 6937998 Sama_2131 anthranilate phosphoribosyltransferase (RefSeq)
Query= SwissProt::P83827 (329 letters) >FitnessBrowser__SB2B:6937998 Length = 344 Score = 253 bits (647), Expect = 4e-72 Identities = 147/315 (46%), Positives = 194/315 (61%), Gaps = 7/315 (2%) Query: 10 GEVLEEEEAYEVMRALMAGEVSPVRAAGLLVALSLRGERPHEIAAMARAMREAAR--PLR 67 G L EEA + +L+ GE+ V A LL+AL +RGE EI+ A AMREAA P Sbjct: 15 GNPLSREEAKCLFASLVRGELDEVTIAALLMALKVRGETIDEISGAADAMREAANSFPRP 74 Query: 68 VHRRPLLDIVGTGGDGKGLMNLSTLAALVAAAGGVAVAKHGNRAASSRAGSADLLEALGV 127 +LDIVGTGGDG +N+ST A VAAA G VAKHGNR+ SS++GS+DLL G+ Sbjct: 75 ALDGGILDIVGTGGDGFNTINISTTATFVAAAAGANVAKHGNRSVSSKSGSSDLLGQFGI 134 Query: 128 DLEAPPERVGEAIEELGFGFLFARVFHPAMRHVAPVRAELGVRTVFNLLGPLTNPAGADA 187 +L P+ +E LG FLFA +H ++H PVR +L RT+FN+LGPL NP+ D Sbjct: 135 ELTMAPQTAANCLEALGICFLFAPHYHGGVKHAVPVRQKLATRTLFNVLGPLINPSHPDF 194 Query: 188 YVLGVFSPEWLAPMAEALERLGA-RGLVVHGEGADELVL-GENRVVEVGKGA---YALTP 242 +LGV+S + P+AE L LG R +VVHGEG DE+ L G +V E+ G Y+L+P Sbjct: 195 MLLGVYSETLVRPIAEVLCALGVKRAMVVHGEGLDEVALHGTTQVCELRNGELVDYSLSP 254 Query: 243 EEVGLKRAPLEALKGGGPEENAALARRLLKGEEKGPLADAVALAAGAGFYAAGKTPSLKE 302 ++ GL+ + L+GG PE+NA + +LKGE K DAVAL AG Y AG + + Sbjct: 255 KDFGLEPVQVTELEGGSPEDNALITAAILKGEGKAAHRDAVALNAGCALYVAGLADTPQA 314 Query: 303 GVALAREVLASGEAY 317 G LA + LASG+AY Sbjct: 315 GFKLAIDTLASGKAY 329 Lambda K H 0.317 0.136 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 299 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 329 Length of database: 344 Length adjustment: 28 Effective length of query: 301 Effective length of database: 316 Effective search space: 95116 Effective search space used: 95116 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate 6937998 Sama_2131 (anthranilate phosphoribosyltransferase (RefSeq))
to HMM TIGR01245 (trpD: anthranilate phosphoribosyltransferase (EC 2.4.2.18))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01245.hmm # target sequence database: /tmp/gapView.1088.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01245 [M=330] Accession: TIGR01245 Description: trpD: anthranilate phosphoribosyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-128 415.1 0.0 1.3e-128 414.9 0.0 1.0 1 lcl|FitnessBrowser__SB2B:6937998 Sama_2131 anthranilate phosphori Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__SB2B:6937998 Sama_2131 anthranilate phosphoribosyltransferase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 414.9 0.0 1.3e-128 1.3e-128 2 326 .. 10 334 .. 9 338 .. 0.98 Alignments for each domain: == domain 1 score: 414.9 bits; conditional E-value: 1.3e-128 TIGR01245 2 eklldnkdLseeeaeqlmkeimsgeasdaqiaAilvalrvkgeteeeiaglakalrekakkveke.eseelvDivGT 77 k + ++ Ls+eea+ l+ +++ge++++ iaA+l+al+v+get++ei+g+a a+re a+ +++ + ++DivGT lcl|FitnessBrowser__SB2B:6937998 10 DKTYGGNPLSREEAKCLFASLVRGELDEVTIAALLMALKVRGETIDEISGAADAMREAANSFPRPaLDGGILDIVGT 86 56788999******************************************************99756778******* PP TIGR01245 78 GGDglktiNiSTasalvaaaaGvkvaKhGnrsvssksGsaDvLealgvnlelspekvarsleevgigFlfAPkyhpa 154 GGDg++tiNiST++ +vaaaaG++vaKhGnrsvssksGs+D+L ++g++l + p+ +a++le +gi+FlfAP+yh + lcl|FitnessBrowser__SB2B:6937998 87 GGDGFNTINISTTATFVAAAAGANVAKHGNRSVSSKSGSSDLLGQFGIELTMAPQTAANCLEALGICFLFAPHYHGG 163 ***************************************************************************** PP TIGR01245 155 lkevapvRkeLgvrtvfNlLGPLlnParaklqvlGvyskdlvevlaevlknlgvkralvvhgedglDEisltgetkv 231 +k+++pvR++L++rt+fN+LGPL+nP ++++ +lGvys+ lv+ +aevl +lgvkra+vvhg +glDE++l+g+t+v lcl|FitnessBrowser__SB2B:6937998 164 VKHAVPVRQKLATRTLFNVLGPLINPSHPDFMLLGVYSETLVRPIAEVLCALGVKRAMVVHG-EGLDEVALHGTTQV 239 **************************************************************.************** PP TIGR01245 232 aelkdgeieeytlspedfglkraeleelkggsaeenaellkevlegkekkakrdivvlNaaaalyvagkakdlkegv 308 +el++ge +y+lsp+dfgl++ +++el+ggs+e+na ++ ++l+g++k a+rd+v+lNa+ alyvag a++ ++g+ lcl|FitnessBrowser__SB2B:6937998 240 CELRNGELVDYSLSPKDFGLEPVQVTELEGGSPEDNALITAAILKGEGKAAHRDAVALNAGCALYVAGLADTPQAGF 316 ***************************************************************************** PP TIGR01245 309 elakeaiksgkaleklee 326 +la +++ sgka+ekl lcl|FitnessBrowser__SB2B:6937998 317 KLAIDTLASGKAYEKLIG 334 **************9965 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (330 nodes) Target sequences: 1 (344 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 9.02 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory