GapMind for Amino acid biosynthesis

 

Alignments for a candidate for ilvE in Shewanella amazonensis SB2B

Align Branched-chain-amino-acid aminotransferase 2; BCAT 2; Vegetative protein 85; VEG85; EC 2.6.1.42 (characterized)
to candidate 6939205 Sama_3299 branched-chain amino acid aminotransferase (RefSeq)

Query= SwissProt::P39576
         (363 letters)



>FitnessBrowser__SB2B:6939205
          Length = 361

 Score =  280 bits (716), Expect = 4e-80
 Identities = 144/344 (41%), Positives = 214/344 (62%), Gaps = 4/344 (1%)

Query: 15  KPKPDPNQLSFGRVFTDHMFVMDYAADKGWYDPRIIPYQPLSMDPAAMVYHYGQTVFEGL 74
           +P      + FG++ TDHMF+MDY  D  W + RI+PY P  M P AM  HYGQ++FEG 
Sbjct: 16  EPFEPQGDVGFGKLRTDHMFMMDYK-DGQWQNARILPYGPFEMMPGAMALHYGQSIFEGA 74

Query: 75  KAYVSEDDHVLLFRPEKNMERLNQSNDRLCIPQIDEEQVLEGLKQLVAIDKDWIPNAEGT 134
           KA++ +D  +  FR +KN +RLN+S D +CIP I E   LE +  L+ +D+ W P  EG 
Sbjct: 75  KAFMHDDGEIYTFRLDKNAQRLNRSADIVCIPNIPEAVQLEAINALIDVDRLWFPRQEGA 134

Query: 135 SLYIRPFIIATEPFLGVAASHTYKLLIILSPVGSYYKEGIKPVKIAVESEFVRAVKGGTG 194
            LYIRPF+ ATE  L V+ ++ Y   ++LSP G+YY + +  +++ + ++F RAV GGTG
Sbjct: 135 CLYIRPFVFATEDRLSVSPANQYTFCVVLSPSGAYYGKNLNAIRLLITTQFHRAVSGGTG 194

Query: 195 NAKTAGNYASSLKAQQVAEEKGFSQVLWLDGIEKKYIEEVGSMNIF-FKINGEIVTPMLN 253
            +K AGNYA+SL+A + A E G +QVL+LD    +YIEEVG+MN F  + +G ++ P   
Sbjct: 195 ASKAAGNYAASLRAGKAAAEHGAAQVLYLDS-TNQYIEEVGAMNHFHIRKDGTLIIPEFT 253

Query: 254 GSILEGITRNSVIALLKHWGLQVSERKIAIDEVIQAHKDGILEEAFGTGTAAVISPVGEL 313
            +IL  IT  S++AL +  G +V +  + + + I   + G + EA G GTAAV+SPVG  
Sbjct: 254 DTILRSITSESILALGEELGCEVRQETVKLSDFIADIEAGEIVEAGGFGTAAVVSPVGSY 313

Query: 314 IWQD-ETLSINNGETGEIAKKLYDTITGIQKGAVADEFGWTTEV 356
           I++D   +++ +G+ GE    +Y   T +QKG      GW  +V
Sbjct: 314 IFEDGRIVTVGDGKVGERISHIYKVYTEMQKGLRPAPEGWVRKV 357


Lambda     K      H
   0.316    0.135    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 334
Number of extensions: 17
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 363
Length of database: 361
Length adjustment: 29
Effective length of query: 334
Effective length of database: 332
Effective search space:   110888
Effective search space used:   110888
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 49 (23.5 bits)

Align candidate 6939205 Sama_3299 (branched-chain amino acid aminotransferase (RefSeq))
to HMM TIGR01123 (ilvE: branched-chain amino acid aminotransferase (EC 2.6.1.42))

Software error:

../bin/blast/fastacmd -i /tmp/list.31459.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.31459.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.