GapMind for Amino acid biosynthesis

 

Alignments for a candidate for ilvI in Shewanella amazonensis SB2B

Align acetolactate synthase (subunit 1/2) (EC 2.2.1.6) (characterized)
to candidate 6937878 Sama_2019 acetolactate synthase 3 regulatory subunit (RefSeq)

Query= BRENDA::P00894
         (163 letters)



>FitnessBrowser__SB2B:6937878
          Length = 164

 Score =  228 bits (582), Expect = 3e-65
 Identities = 114/163 (69%), Positives = 138/163 (84%)

Query: 1   MRRILSVLLENESGALSRVIGLFSQRGYNIESLTVAPTDDPTLSRMTIQTVGDEKVLEQI 60
           MRRI+SVLLEN+ GALSRV+GLFSQRGYNIE LTVAPTDD TLSRM I    DE VLEQI
Sbjct: 1   MRRIISVLLENQPGALSRVVGLFSQRGYNIECLTVAPTDDATLSRMNITVAADEMVLEQI 60

Query: 61  EKQLHKLVDVLRVSELGQGAHVEREIMLVKIQASGYGRDEVKRNTEIFRGQIIDVTPSLY 120
           EKQLHKL+DVL+VS + + AH+ERE+ LVK++A    R+E+KR+ +IFRGQI+DVT S Y
Sbjct: 61  EKQLHKLIDVLKVSNITESAHIERELALVKVKAQSEVREEIKRSADIFRGQIVDVTASHY 120

Query: 121 TVQLAGTSGKLDAFLASIRDVAKIVEVARSGVVGLSRGDKIMR 163
           T+QLAGT+ KLDAF+ ++ +V K+VEV+RSGVVGLSRGDK MR
Sbjct: 121 TIQLAGTTEKLDAFINALAEVTKVVEVSRSGVVGLSRGDKSMR 163


Lambda     K      H
   0.318    0.136    0.360 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 129
Number of extensions: 1
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 163
Length of database: 164
Length adjustment: 18
Effective length of query: 145
Effective length of database: 146
Effective search space:    21170
Effective search space used:    21170
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 43 (21.2 bits)

Align candidate 6937878 Sama_2019 (acetolactate synthase 3 regulatory subunit (RefSeq))
to HMM TIGR00119 (ilvN: acetolactate synthase, small subunit (EC 2.2.1.6))

Software error:

../bin/blast/fastacmd -i /tmp/list.26722.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.26722.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.