Align Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 (uncharacterized)
to candidate SMa2400 SMa2400 diaminobutyrate--2-oxoglutarate aminotransferase
Query= curated2:A0QYS9 (390 letters) >FitnessBrowser__Smeli:SMa2400 Length = 470 Score = 215 bits (547), Expect = 2e-60 Identities = 148/418 (35%), Positives = 213/418 (50%), Gaps = 56/418 (13%) Query: 19 PLSLVSGEGAVVTDADGREYLDLLGGIAVNLLGHRHPAVIEAVTTQLDTLGHTSNLYATE 78 P++L S G +VTD DGR YLD L G LGH HP VIE T LG L+ + Sbjct: 50 PVALKSASGCIVTDVDGRSYLDCLAGAGTLALGHNHPEVIE---TLQQVLGSGLPLHTLD 106 Query: 79 PGIALAEALVGQL-GT-------QARVFFCN-SGTEANEVAFKITRL-TGKTKIVAAEGA 128 + + V + GT +A++ FC+ SGT+A E A K+ + TG+T +V+ GA Sbjct: 107 LTTPVKDRFVSDIFGTLPAGLRDEAKIQFCSPSGTDAVEAAIKLAKTATGRTDLVSFRGA 166 Query: 129 FHGRTMGSLALTGQPSKQAPFEPLPGNVMHVPY------------GDVAAL-----EAAV 171 +HG + GSL+L G +A L PY + A L E A+ Sbjct: 167 YHGMSQGSLSLMGSLGPKASVGQLVPGAHFFPYPYAYRCPFGRGGNETATLAAEYFERAL 226 Query: 172 DD------QTAAVFLEPIMGEGGVVVPPAGYLVAAREITSKHGALLVLDEVQTGVGRTGA 225 D + AAV LE + GEGGV+ P +L A R +T G L++DEVQ+GVGRTG+ Sbjct: 227 RDPEGGINRPAAVILEAVQGEGGVIPAPVEWLRAVRRVTRDLGIPLIVDEVQSGVGRTGS 286 Query: 226 FFAHQHDGIVPDVVTMAKGLGGGLPIGACLAVGATGDLLTPGLHGSTFGGNPVCTAAGLA 285 F+A Q GI+PDVV ++K +GGGLP+ A + DL PG H TF GN + AAG Sbjct: 287 FYAFQKAGIIPDVVVLSKAIGGGLPL-AVVIYREDLDLWKPGAHAGTFRGNQLAMAAGSK 345 Query: 286 VLKTLAAEDLVARAGVLGKTLSHGIEELG--HPLVDKVRGKGLLQGIVLTVPS------- 336 L+ + E LV RA + G+ L +E + P + +VRG+GL+ G+ + P Sbjct: 346 TLEIIERERLVERAAIAGRRLRANLERIAAQTPYIGEVRGEGLMLGVEVVDPEGLPDALG 405 Query: 337 --------AKAVETAARDAGFLVNAAA--PEVVRLAPPLIITEGQIEAFITALPAVLD 384 A+ ++ AG ++ V+RL PPL+I++ +I+ AL A + Sbjct: 406 HPPHGQEIARMIQHEMFRAGIILETGGRFGSVLRLLPPLVISDAEIDQVSGALAAAFE 463 Lambda K H 0.317 0.136 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 522 Number of extensions: 31 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 390 Length of database: 470 Length adjustment: 32 Effective length of query: 358 Effective length of database: 438 Effective search space: 156804 Effective search space used: 156804 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory