Align asparagine synthase (glutamine-hydrolysing) 1; EC 6.3.5.4 (characterized)
to candidate SM_b20481 SM_b20481 asparagine synthetase (glutamine amidotransferase) protein
Query= CharProtDB::CH_005185 (632 letters) >FitnessBrowser__Smeli:SM_b20481 Length = 591 Score = 254 bits (648), Expect = 1e-71 Identities = 192/632 (30%), Positives = 307/632 (48%), Gaps = 71/632 (11%) Query: 1 MCGFVGV--FNKHPLAQTADQEELIKQMNQMIVHRGPDSDGYFHDEHVGFGFRRLSIIDV 58 MCG G F+ + TA + M ++ RGPD+ G +VG G RRL I+D+ Sbjct: 1 MCGICGEVRFDGGSPSVTA-----VSIMADVLAPRGPDASGVVVRGNVGLGHRRLRILDL 55 Query: 59 -ENGGQPLSYEDETYWIIFNGEIYNYIELREELEAKGYTFNTDSDTEVLLATYRHYKEEA 117 + QP+ D ++FNG IYN+ ELR ELE KGY F + DTEV+L + + EE Sbjct: 56 SDKSQQPMVDSDLGLSLVFNGCIYNFRELRLELEEKGYRFFSSGDTEVILKAWHAWGEEC 115 Query: 118 ASKLRGMFAFLIWNKNDHVLYGARDPFGIKPLYYTTINDQVYFASERKSLMVAQN-DIEI 176 S+ GMFAF+I ++ + ARD FGIKPLY + + FAS +L+ A D I Sbjct: 116 VSRFHGMFAFVIHERDSGRVVMARDRFGIKPLYIAEVQGALRFASALPALVKAGGVDTSI 175 Query: 177 DKEALQQYMSFQ-FVPEPSTLDAHVKKVEPGSQFTIRPDGDITFKTYFKANFK----PVQ 231 D AL YM+F VP P T+ V+K+ P + DG + Y+ ++ Sbjct: 176 DVAALHNYMTFHAVVPPPRTILNGVRKLPPATLRVYERDGSFEDRRYWDPPYRRQAGDAA 235 Query: 232 TEEDKLVKEVRDAIYDSVNVHMRSDVPVGSFLSGGIDSSFIVS-VAKEFHPSLKTFSVGF 290 ++ +++ DA+ +V M +DVPVG LSGG+DSS IV +A+ L +FSVGF Sbjct: 236 ISREEWQEQLLDALRIAVKRRMVADVPVGVLLSGGVDSSLIVGLLAEAGQRGLMSFSVGF 295 Query: 291 EQQGFSEVD---VAKETAAALGIENISKVISPEEYMNELPKIVWHFDDPLADPAAIPLYF 347 E+ + D + A G ++ + + M LP + +P+ + Y Sbjct: 296 EEANGEKGDEFVYSDLIAGHFGTDHRKIFVPSADLMGALPGTIAAMSEPMVSYDNVGFYL 355 Query: 348 VAKEAKKHVTVALSGEGADELFGGYNIYREPLSLKPFERIPSGLKKMLLHVAAVMPEGMR 407 ++KE KHV V SG+GADE+FGGY+ Y L++ V+ + Sbjct: 356 LSKEVSKHVKVVQSGQGADEVFGGYHWY-----------------PPLMNSNDVVAD--Y 396 Query: 408 GKSLLERG----CTPLQDRYIGNAKIFEESVKKQLLKHYNPNLSYRDVTKTYFTESSSYS 463 GK+ +R T L D +I + + + + + LL+ + + Sbjct: 397 GKAFRDRSHAVLTTQLSDAWIADHDVSGDLLNEHLLR------------------EGAAT 438 Query: 464 DINKMQYVDIHTWMRGDILLKADKMTMANSLELRVPFLDKVVFDVASKIPDELKTKNGTT 523 +++ +D + + D + + D MTMA LE RVPFLD + ++A+++P E K ++G Sbjct: 439 PVDQALRLDSNVMLVDDPVKRVDNMTMAWGLEARVPFLDHELVELAARMPPEEKLRDG-G 497 Query: 524 KYLLRKAAEGIVPEHVLNRKKLGFPVPIRHWLKNEMNEWVRNIIQESQT-------DAYI 576 K +L+ A ++P V++RKK FPVP ++ + +R+ ++ + DAY+ Sbjct: 498 KGILKDVARRVIPSEVIDRKKGYFPVPQLKYIAGPYLDLIRDTLRSQKARERGLFQDAYL 557 Query: 577 HKDYVLQLLEDHCADKADNSRKIWTVLIFMIW 608 D + Q DH ++W V + +W Sbjct: 558 --DRLFQEPSDHITPL--RGSELWQVGLLEMW 585 Lambda K H 0.319 0.136 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 886 Number of extensions: 47 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 632 Length of database: 591 Length adjustment: 37 Effective length of query: 595 Effective length of database: 554 Effective search space: 329630 Effective search space used: 329630 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
Align candidate SM_b20481 SM_b20481 (asparagine synthetase (glutamine amidotransferase) protein)
to HMM TIGR01536 (asnB: asparagine synthase (glutamine-hydrolyzing) (EC 6.3.5.4))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01536.hmm # target sequence database: /tmp/gapView.5416.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01536 [M=517] Accession: TIGR01536 Description: asn_synth_AEB: asparagine synthase (glutamine-hydrolyzing) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.3e-133 430.6 0.0 6.1e-133 430.4 0.0 1.0 1 lcl|FitnessBrowser__Smeli:SM_b20481 SM_b20481 asparagine synthetase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Smeli:SM_b20481 SM_b20481 asparagine synthetase (glutamine amidotransferase) protein # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 430.4 0.0 6.1e-133 6.1e-133 1 516 [. 2 520 .. 2 521 .. 0.90 Alignments for each domain: == domain 1 score: 430.4 bits; conditional E-value: 6.1e-133 TIGR01536 1 CgiagivdlkakakeeeeaikemletlahRGPDaegvwkdekeenailghrRLaiidlseg.aQPlsnek.evv 72 Cgi g v + + + a++ m+++la RGPDa+gv n++lghrRL i dls++ +QP+ + + lcl|FitnessBrowser__Smeli:SM_b20481 2 CGICGEVRFDGGSPS-VTAVSIMADVLAPRGPDASGVVVR---GNVGLGHRRLRILDLSDKsQQPMVDSDlGLS 71 9*******9887555.689*****************8666...9****************99*********99* PP TIGR01536 73 ivfnGEIYNheeLreeleekGyeFetksDtEViLaayeewgeelverLeGmFAfalwdekkgelflaRDrlGik 146 +vfnG IYN++eLr eleekGy+F + DtEViL+a+++wgee+v+r++GmFAf+++++ +g++++aRDr+Gik lcl|FitnessBrowser__Smeli:SM_b20481 72 LVFNGCIYNFRELRLELEEKGYRFFSSGDTEVILKAWHAWGEECVSRFHGMFAFVIHERDSGRVVMARDRFGIK 145 ************************************************************************** PP TIGR01536 147 PLYyaseqgkllfaSEiKallalkeikaeldkealaelltlq.lvptektlfkevkelepakal..dgeeklee 217 PLY a+ qg+l faS + al+++ +++++d +al++++t++ +vp+++t+ ++v++l+pa + + + ++e+ lcl|FitnessBrowser__Smeli:SM_b20481 146 PLYIAEVQGALRFASALPALVKAGGVDTSIDVAALHNYMTFHaVVPPPRTILNGVRKLPPATLRvyERDGSFED 219 ******************************************999****************9999844455554 PP TIGR01536 218 ..ywevekee....vkeseeelveelrelledavkkrlvadvpvgvllSGGlDSslvaaiakkeaksevktFsi 285 yw+ +++ + s ee e+l ++l+ avk+r+vadvpvgvllSGG+DSsl++ ++++ ++ + +Fs+ lcl|FitnessBrowser__Smeli:SM_b20481 220 rrYWDPPYRRqagdAAISREEWQEQLLDALRIAVKRRMVADVPVGVLLSGGVDSSLIVGLLAEAGQRGLMSFSV 293 55****99997777778899999*************************************************** PP TIGR01536 286 gfe..dskdldeskaarkvadelgtehkevliseeevlkeleevilaleeptairasiplyllsklarekgvkV 357 gfe + ++ de + +a ++gt+h+++ + +++++ +l+ i a+ ep+ + ++ yllsk+++++ vkV lcl|FitnessBrowser__Smeli:SM_b20481 294 GFEeaNGEKGDEFVYSDLIAGHFGTDHRKIFVPSADLMGALPGTIAAMSEPMVSYDNVGFYLLSKEVSKH-VKV 366 ***66667777788********************************************************.*** PP TIGR01536 358 vLsGeGaDElfgGYeyfreakaeealelpeaselaekklllqaklakeselkellkakleeelkekeelkkelk 431 v sG+GaDE+fgGY+++ +++++ + + ++ +++ a l+++ +++ ++ ++++ +l + + l + lcl|FitnessBrowser__Smeli:SM_b20481 367 VQSGQGADEVFGGYHWYPPLMNSNDVVADYGKAFRDRSH---AVLTTQLSDAWIADHDVSGDLLNEHLLRE--G 435 ********************9999997444444444333...33444444444444444444444443333..3 PP TIGR01536 432 eeseleellrldlelllsdl.lrakDrvsmahslEvRvPflDkelvelalsippelklrdgkeKvlLreaaeel 504 +++ ++++lrld + +l d+ +++ D ++ma++lE+RvPflD+elvela+++ppe klrdg K +L+ +a+++ lcl|FitnessBrowser__Smeli:SM_b20481 436 AATPVDQALRLDSNVMLVDDpVKRVDNMTMAWGLEARVPFLDHELVELAARMPPEEKLRDG-GKGILKDVARRV 508 3478999999999988877626666**********************************98.79********** PP TIGR01536 505 lPeeileRkKea 516 +P+e+ +RkK lcl|FitnessBrowser__Smeli:SM_b20481 509 IPSEVIDRKKGY 520 *********965 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (517 nodes) Target sequences: 1 (591 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.03 # Mc/sec: 8.08 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory