GapMind for Amino acid biosynthesis

 

Alignments for a candidate for aroG in Sinorhizobium meliloti 1021

Align 3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54) (characterized)
to candidate SMc00155 SMc00155 DAHP synthetase prtein

Query= BRENDA::P29976
         (525 letters)



>FitnessBrowser__Smeli:SMc00155
          Length = 457

 Score =  531 bits (1367), Expect = e-155
 Identities = 260/454 (57%), Positives = 330/454 (72%), Gaps = 2/454 (0%)

Query: 72  ALKWTPESWKLKKALQLPDYPNANELESVLKTIEAFPPIVFAGEARNLEERLADAAVGKA 131
           A  WTP SW+ K   Q+PDYP+   L+SV   +  +PP+VFAGEAR L+  LA+ A G+ 
Sbjct: 2   AQTWTPNSWRQKPIQQVPDYPDLAVLDSVEARLAKYPPLVFAGEARRLKSALANVAEGRG 61

Query: 132 FLLQGGDCAESFKEFNATNIRDTFRVLLQMSIVLTFGGQVPVIKVGRMAGQFAKPRSDAF 191
           FLLQGGDCAESF E  A  IRD FR  LQM++VLTFG Q PV+KVGR+AGQFAKPRS   
Sbjct: 62  FLLQGGDCAESFAEHGADTIRDFFRAFLQMAVVLTFGAQQPVVKVGRIAGQFAKPRSSGV 121

Query: 192 EEKDGVKLPSYKGDNINGDTFDEKSRIPDPNRMIRAYTQSAATLNLLRAFATGGYAAIQR 251
           E++  V LPSY+GD ING  F E++R+P+P R + AY QSAATLNLLRAFA GGYA ++ 
Sbjct: 122 EKQGDVTLPSYRGDIINGIEFTEEARVPNPERQVMAYRQSAATLNLLRAFAMGGYANLEN 181

Query: 252 VTQWNLDFVEQSEQADRYQELANRVDEALGFMSACGL-GTDHPLMTTTDFYTSHECLLLP 310
           V QW L FV+ S QA+RY++LA+R+ E + FM A G+   +HP +  TDF+TSHE LLL 
Sbjct: 182 VHQWMLGFVKDSPQAERYRKLADRISETMDFMKAIGITAENHPSLRETDFFTSHEALLLG 241

Query: 311 YEQSLTRLDSTSGLYYDCSAHMVWCGERTRQLDGAHVEFLRGIANPLGIKVSNKMDPFEL 370
           YEQ+LTR+DSTSG +Y  S HM+W G+RTRQ D AH+E+ RGI NPLG+K    +    L
Sbjct: 242 YEQALTRVDSTSGDWYATSGHMIWIGDRTRQPDHAHIEYCRGIKNPLGLKCGPSLTADGL 301

Query: 371 VKLVEILNPNNKPGRITVIVRMGAENMRVKLPHLIRAVRRSGQIVTWVCDPMHGNTIKAP 430
           ++L++ILNP N+ GR+T+I R G + +   LP LIRAV R G+ V W CDPMHGNTI   
Sbjct: 302 LELIDILNPANEAGRLTLICRFGHDKVAEHLPRLIRAVEREGKKVVWSCDPMHGNTITLN 361

Query: 431 CGLKTRAFDSILAEVRAFLDVHEQEGSHAGGIHLEMTGQNVTECIGGSRTVTYDDLSSRY 490
              KTR F+ IL+EV +F  +H  EGSH GGIH+EMTG +VTEC GG+R ++ DDL+ RY
Sbjct: 362 -NYKTRPFERILSEVESFFQIHRAEGSHPGGIHIEMTGNDVTECTGGARALSGDDLADRY 420

Query: 491 HTHCDPRLNASQSLELAFIVAERLRKRRTGSQRV 524
           HTHCDPRLNA Q+LELAF++AER++  R   + V
Sbjct: 421 HTHCDPRLNADQALELAFLLAERMKGGRDEKKMV 454


Lambda     K      H
   0.318    0.132    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 651
Number of extensions: 25
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 525
Length of database: 457
Length adjustment: 34
Effective length of query: 491
Effective length of database: 423
Effective search space:   207693
Effective search space used:   207693
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 52 (24.6 bits)

Align candidate SMc00155 SMc00155 (DAHP synthetase prtein)
to HMM TIGR01358 (3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54))

Software error:

../bin/blast/fastacmd -i /tmp/list.22087.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.22087.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.