Align Shikimate kinase; Short=SK; EC 2.7.1.71 (characterized, see rationale)
to candidate SMa0514 SMa0514 gluconate kinase
Query= uniprot:A0A135IJ25 (196 letters) >FitnessBrowser__Smeli:SMa0514 Length = 172 Score = 42.0 bits (97), Expect = 6e-09 Identities = 33/104 (31%), Positives = 48/104 (46%), Gaps = 6/104 (5%) Query: 17 PGALKKTIVMVGMMGAGKTAVGRALAARLQAPFLDSD--HEIEAAANRTIPEIFARDGEP 74 P + ++ IV++G+ G GK+A+G ALA RL A ++D D H E A + E D Sbjct: 3 PHSARRGIVLMGVAGCGKSAIGAALATRLGATYVDGDDLHPPENIARMSRGEPLTDDD-- 60 Query: 75 FFRKKERQVIRRLLDEERGVLSTGGGAFLAEENRQIISERGVAI 118 R ++ R L GVL G A I +E G + Sbjct: 61 --RWPWLTLVGRRLAAPDGVLIIGCSALKRRYRDHIRNEAGAPV 102 Lambda K H 0.319 0.135 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 70 Number of extensions: 2 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 196 Length of database: 172 Length adjustment: 19 Effective length of query: 177 Effective length of database: 153 Effective search space: 27081 Effective search space used: 27081 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 44 (21.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory