Align triose-phosphate isomerase (EC 5.3.1.1) (characterized)
to candidate SMc01614 SMc01614 triosephosphate isomerase
Query= BRENDA::Q7X216 (265 letters) >FitnessBrowser__Smeli:SMc01614 Length = 255 Score = 203 bits (517), Expect = 3e-57 Identities = 116/255 (45%), Positives = 158/255 (61%), Gaps = 8/255 (3%) Query: 5 IWLGTSWKMNKPLSQAMAWCETLAARMPEGCHPAIQPFVIPSFTAIQPVSHFLQTHQLPL 64 +W+GTSWKMNK L++AM + + LAA + IQ FVIP FTA + V L+ + + Sbjct: 6 LWVGTSWKMNKTLAEAMVFADGLAAA-DDARDQRIQRFVIPPFTAARQVKERLKATSVKV 64 Query: 65 LTGAQNMHEADQGAWTGEISAAMLAETGATLVELGHSERRAAFNESDAAINRKVHSALGH 124 GAQNMH D GAWTGEIS ML++ +VELGHSERR F E+D + K +A+ H Sbjct: 65 --GAQNMHWDDAGAWTGEISPVMLSDCDLDIVELGHSERREHFGETDRTVGLKTAAAVKH 122 Query: 125 GLRPLICIGDSAEEKRWQVSRESVVRQMKIALYGL-SHQQALRTLIAYEPVWAIGEHGTP 183 GL PLICIG++ ++ + + RQ++ A L + L+AYEPVWAIG +G P Sbjct: 123 GLVPLICIGETLAQREAGEADTVLKRQVEGAFAFLEGAARKAPVLLAYEPVWAIGVNGIP 182 Query: 184 ASPQEAGVIHQALRQALCERFGHETGTRIPLLYGGXVTLQNAVELLRQQEINGLFIGRAA 243 A+ A H+ + + + ER G ++P+LYGG V QN EL+ Q I+GLFIGR+A Sbjct: 183 ATADYADARHRLIGE-VAER---ALGVKVPVLYGGSVNPQNCEELILQPHIDGLFIGRSA 238 Query: 244 WDAQGYCDIVQRVTQ 258 WD GY DI+QRV + Sbjct: 239 WDVGGYLDILQRVAR 253 Lambda K H 0.321 0.133 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 231 Number of extensions: 9 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 265 Length of database: 255 Length adjustment: 24 Effective length of query: 241 Effective length of database: 231 Effective search space: 55671 Effective search space used: 55671 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
Align candidate SMc01614 SMc01614 (triosephosphate isomerase)
to HMM TIGR00419 (tpiA: triose-phosphate isomerase (EC 5.3.1.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00419.hmm # target sequence database: /tmp/gapView.14791.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00419 [M=228] Accession: TIGR00419 Description: tim: triose-phosphate isomerase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-43 135.0 0.0 2.3e-43 134.7 0.0 1.0 1 lcl|FitnessBrowser__Smeli:SMc01614 SMc01614 triosephosphate isomera Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Smeli:SMc01614 SMc01614 triosephosphate isomerase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 134.7 0.0 2.3e-43 2.3e-43 2 221 .. 8 235 .. 7 239 .. 0.91 Alignments for each domain: == domain 1 score: 134.7 bits; conditional E-value: 2.3e-43 TIGR00419 2 viinfKlnesvgkvelevaklae.evaseagvevavappfvdldvvkdeve.seiqvaAqnvdavksGaftGeis 74 v+ +K+n ++ + la+ + a + ++ v ppf + vk++++ + ++v+Aqn++ ++Ga+tGeis lcl|FitnessBrowser__Smeli:SMc01614 8 VGTSWKMNKTLAEAMVFADGLAAaDDARDQRIQRFVIPPFTAARQVKERLKaTSVKVGAQNMHWDDAGAWTGEIS 82 6789**********9999999988999999*********************899********************* PP TIGR00419 75 AemlkdlGakgvligHsErRsllkeadeliekkvarlkelglksvvCvgetleereaartinnvatta..aaaA. 146 ml d+ v +gHsErR ++ e+d ++ k a + + gl +++C+getl++rea++ ++v++ + +a A lcl|FitnessBrowser__Smeli:SMc01614 83 PVMLSDCDLDIVELGHSERREHFGETDRTVGLKTAAAVKHGLVPLICIGETLAQREAGEA-DTVLKRQveGAFAf 156 ********************************************************8876.45544441134446 PP TIGR00419 147 ......lepdvvAvEPveliG.tGkpvskAeaevveksvrdhlkkvskevaesvrvlyGasvtaaedaelaaqld 214 p+++A+EPv++iG G+p++ a++ + + + +++ + +v vlyG+sv+ +++ el++q+ lcl|FitnessBrowser__Smeli:SMc01614 157 legaarKAPVLLAYEPVWAIGvNGIPATADYADARHRLIG---EVAERALGVKVPVLYGGSVNPQNCEELILQPH 228 6666667899***********56**************999...668899999*********************** PP TIGR00419 215 vdGvLla 221 +dG+ ++ lcl|FitnessBrowser__Smeli:SMc01614 229 IDGLFIG 235 ****998 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (228 nodes) Target sequences: 1 (255 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 9.90 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory