Align Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B; Asp/Glu-ADT subunit B; EC 6.3.5.- (characterized)
to candidate SMc01350 SMc01350 aspartyl/glutamyl-tRNA amidotransferase subunit B
Query= SwissProt::Q9RF06 (475 letters) >FitnessBrowser__Smeli:SMc01350 Length = 516 Score = 424 bits (1089), Expect = e-123 Identities = 225/478 (47%), Positives = 314/478 (65%), Gaps = 11/478 (2%) Query: 3 FETVIGLEVHVELKTDSKMFSPSPAHFGAEPNSNTNVIDLAYPGVLPVVNKRAVDWAMRA 62 +E +IG+EVH ++ ++SK+FS + FG+EPN+N +++D A PG+LPV+N+ V A+R Sbjct: 38 WEVIIGMEVHAQVLSNSKLFSSASTEFGSEPNANVSLVDAAMPGMLPVINEECVKQAVRT 97 Query: 63 AMALNMEIATESKFDRKNYFYPDNPKAYQISQFDQPIGENGYIDIEVDGETK------RI 116 + L +I S FDRKNYFYPD P+ YQISQ+ PI G I I V + + I Sbjct: 98 GLGLKAKINNRSIFDRKNYFYPDLPQGYQISQYKDPIVGEGKIIISVGPDRQGQFEDVEI 157 Query: 117 GITRLHMEEDAGKSTHKGE--YSLVDLNRQGTPLIEIVSEPDIRSPKEAYAYLEKLRSII 174 GI RLH+E+DAGKS H S VDLNR G L+EIVS+PD+RS EA AYL KLRSI+ Sbjct: 158 GIERLHLEQDAGKSMHDQHPAMSYVDLNRSGVALMEIVSKPDLRSSDEAKAYLTKLRSIL 217 Query: 175 QYTGVSDVKMEEGSLRCDANISLRPYGQEKFGTKAELKNLNSFNYVRKGLEYEEKRQEEE 234 +Y G D M+EGS+R D N+S+R G E FGT+ E+KN+NS +V + +EYE +RQ Sbjct: 218 RYLGTCDGNMDEGSMRADVNVSVRRPG-EAFGTRCEIKNVNSIRFVGQSIEYEARRQIAI 276 Query: 235 LLSGGEIGQETRRFDESTGKTILMRVKEGSDDYRYFPEPDIVPLYIDDAWKERVRQTIPE 294 L GG I QETR FD + G+T MR KE + DYRYFP+PD++PL DDA+ E ++ +PE Sbjct: 277 LEDGGAIDQETRLFDANKGETRSMRSKEEAHDYRYFPDPDLLPLEFDDAFVEALKADLPE 336 Query: 295 LPDERKAKYVNELGLPAYDAHVLTLTKEMSDFFESTIEHGADVKLTSNWLMGGVNEYLNK 354 LPD++K ++V +LGL YDA VL K ++D+FE+ E G D K +NW++ + LNK Sbjct: 337 LPDDKKERFVRDLGLSVYDASVLVSEKAIADYFEAVAE-GRDGKAAANWVINDLLGALNK 395 Query: 355 NQVELLDTKLTPENLAGMIKLIEDGTMSSKIAKKVFPELAAKGGNAKQIMEDNGLVQISD 414 + +T ++P L G+I LI+DGT+S K+AK VF L +GG+ +I+E G+ Q++D Sbjct: 396 AGKTIEETPVSPAQLGGIIDLIKDGTISGKLAKDVFEILWNEGGDPAEIVESRGMKQVTD 455 Query: 415 EATLLKFVNEALDNNEQSVEDYKNGKGKAMGFLVGQIMKASKGQANPQLVNQLLKQEL 472 + K V+E + N VE K K G+ VGQ+MKA+ G+ANPQ V L+K +L Sbjct: 456 TGAIEKAVDEIIAANPDQVEKAK-AKPSLAGWFVGQVMKATGGKANPQAVQALVKSKL 512 Lambda K H 0.313 0.133 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 722 Number of extensions: 33 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 475 Length of database: 516 Length adjustment: 34 Effective length of query: 441 Effective length of database: 482 Effective search space: 212562 Effective search space used: 212562 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 52 (24.6 bits)
Align candidate SMc01350 SMc01350 (aspartyl/glutamyl-tRNA amidotransferase subunit B)
to HMM TIGR00133 (gatB: aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit (EC 6.3.5.-))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00133.hmm # target sequence database: /tmp/gapView.27014.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00133 [M=481] Accession: TIGR00133 Description: gatB: aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.5e-168 545.6 0.0 5.1e-168 545.4 0.0 1.0 1 lcl|FitnessBrowser__Smeli:SMc01350 SMc01350 aspartyl/glutamyl-tRNA Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Smeli:SMc01350 SMc01350 aspartyl/glutamyl-tRNA amidotransferase subunit B # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 545.4 0.0 5.1e-168 5.1e-168 3 480 .. 37 512 .. 35 513 .. 0.97 Alignments for each domain: == domain 1 score: 545.4 bits; conditional E-value: 5.1e-168 TIGR00133 3 eyelviGlEvHvqlntksKlFckcsneaqeakpNtnvcpvclglPGalPvlNkeavkkAlklalalnskivsevs 77 ++e++iG+EvH q+ +sKlF+++s+e+ + +pN nv+ v+ ++PG lPv+N+e vk+A+ +l l++ki+ + s lcl|FitnessBrowser__Smeli:SMc01350 37 DWEVIIGMEVHAQVLSNSKLFSSASTEFGS-EPNANVSLVDAAMPGMLPVINEECVKQAVRTGLGLKAKIN-NRS 109 679***************************.**************************************65.7** PP TIGR00133 78 vFdRKhYfYpDlPkgyqitqqdlPiaedGkleieleeke......keigierlhlEeDtgksqykesdkdkqslv 146 +FdRK+YfYpDlP+gyqi+q++ Pi+ +Gk+ i++ + eigierlhlE+D+gks++ ++ + +s+v lcl|FitnessBrowser__Smeli:SMc01350 110 IFDRKNYFYPDLPQGYQISQYKDPIVGEGKIIISVGPDRqgqfedVEIGIERLHLEQDAGKSMHDQH--PAMSYV 182 *********************************99776667787789*****************966..79**** PP TIGR00133 147 DfNRsgvPLlEiVtkPdlksakearaflkklrqilryleisdgdleeGsmRvDvNvsirlkGqekegtrvEiKNl 221 D+NRsgv L+EiV+kPdl+s++ea+a+l klr+ilryl+ dg+++eGsmR+DvNvs+r + e++gtr EiKN+ lcl|FitnessBrowser__Smeli:SMc01350 183 DLNRSGVALMEIVSKPDLRSSDEAKAYLTKLRSILRYLGTCDGNMDEGSMRADVNVSVR-RPGEAFGTRCEIKNV 256 ***********************************************************.55678********** PP TIGR00133 222 nslksiekaieyEieRqkkllkkgeevkqetrafdekksitvslRkKeeseDYRYfpePdlppieideevvkekv 296 ns++ + + ieyE Rq+++l++g + qetr fd +k t s+R+Kee++DYRYfp+Pdl p+e+d+ +v+ + lcl|FitnessBrowser__Smeli:SMc01350 257 NSIRFVGQSIEYEARRQIAILEDGGAIDQETRLFDANKGETRSMRSKEEAHDYRYFPDPDLLPLEFDDAFVEA-L 330 **********************************************************************999.* PP TIGR00133 297 eeklpelPeakrirlkkeyglseedakvlvsdlelldafeevvklikepklavnWileellgeLnkkkislaeal 371 ++ lpelP+ k++r+++++gls +da vlvs++ ++d+fe v++ + k+a+nW++++llg Lnk +++e+ lcl|FitnessBrowser__Smeli:SMc01350 331 KADLPELPDDKKERFVRDLGLSVYDASVLVSEKAIADYFEAVAEGRDG-KAAANWVINDLLGALNKAGKTIEETP 404 ****************************************99987766.************************** PP TIGR00133 372 lkpeelaeliklikegkisqksakelleellenkkdpkklieklgliqisdekelvkiveevikenpkevekyks 446 ++p +l +i+lik+g+is+k ak+++e l ++++dp +++e +g+ q++d+ ++ k+v+e+i+ np++vek k+ lcl|FitnessBrowser__Smeli:SMc01350 405 VSPAQLGGIIDLIKDGTISGKLAKDVFEILWNEGGDPAEIVESRGMKQVTDTGAIEKAVDEIIAANPDQVEKAKA 479 ***********************************************************************9875 PP TIGR00133 447 gkekalkflvGqvmkktkgradpkevekllkell 480 k ++ +++vGqvmk t g+a+p+ v++l+k +l lcl|FitnessBrowser__Smeli:SMc01350 480 -KPSLAGWFVGQVMKATGGKANPQAVQALVKSKL 512 .67899************************9987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (481 nodes) Target sequences: 1 (516 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.02 # Mc/sec: 11.40 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory