GapMind for Amino acid biosynthesis

 

Alignments for a candidate for hisC in Sinorhizobium meliloti 1021

Align histidinol-phosphate aminotransferase [EC:2.6.1.9] (characterized)
to candidate SMc00710 SMc00710 histidinol-phosphate aminotransferase

Query= reanno::Phaeo:GFF2492
         (361 letters)



>FitnessBrowser__Smeli:SMc00710
          Length = 368

 Score =  356 bits (913), Expect = e-103
 Identities = 186/358 (51%), Positives = 235/358 (65%), Gaps = 8/358 (2%)

Query: 5   APQPGILDIALYEGGAAHVKGMSNVTKLSSNENPLGPSPKAIEAMQAAVSEMHRYPSSDH 64
           AP+ GILDIA Y  G  H  G++ V KLSSNE PLG SP+AIEA Q A   + RYP    
Sbjct: 9   APRSGILDIAAYVPGKEHAPGVAKVHKLSSNETPLGASPRAIEAFQKAAFNLERYPDGQA 68

Query: 65  SGLRQAIGEVYGLPMEQIICGAGSDEIITFLCQAYAGPGDEVLFTEHGFAMYRISALAAG 124
           + L++AI  V+GL    I+CG GSDE++  LC  Y GPGDE + TEHGF +Y+I   A+G
Sbjct: 69  NALKEAIAAVHGLNPANILCGNGSDELLGLLCHTYLGPGDEGIVTEHGFLVYKIQITASG 128

Query: 125 ATPVEVAERDRVTDVDALLAGCTERTRLVFIANPNNPTGTMIGMADLARLADGLPKGALL 184
            TPV V ER    DVDA+LA  TERT++VFIANP NPTGT I + ++ RL  GLP G LL
Sbjct: 129 GTPVTVKERQERVDVDAILAAVTERTKIVFIANPANPTGTYIPVEEVRRLHAGLPAGVLL 188

Query: 185 VLDGAYAEYV--EGYDAGAALVANRDNVVMTRTFSKIYGLGGARVGWGYAPKPIIDVLNR 242
           VLD AYAEYV    Y+AG  LV++  NVVMTRTFSKIYGL G R+GW YAP+ +++ L+R
Sbjct: 189 VLDAAYAEYVRRNDYEAGLELVSSNRNVVMTRTFSKIYGLAGLRIGWMYAPRDVVEALDR 248

Query: 243 VRGPFNLSSTALAGAEAAVRDTDYTEHCRKENAKWRTWLAEALAELGVPSDTSCANFILA 302
           VRGPFNL++ A+A   AA+RD  +      +N  W   + +AL ++G+    S  NF+L 
Sbjct: 249 VRGPFNLNAAAIAAGAAAIRDQAFVAAAVDQNHTWLAKIGQALTDIGLRVTPSVTNFVLI 308

Query: 303 RFASPEEAGA----CDAFLQSRGLIVRRVTGYKLPAALRITVGDETACNALVAAMKVF 356
            F  PEEAG      DA+L SRG I+R V  Y  P ALR+T+G E A   +VAA+  F
Sbjct: 309 HF--PEEAGMSASDADAYLTSRGFILRAVGAYGFPNALRMTIGSEEANKGVVAALTEF 364


Lambda     K      H
   0.318    0.134    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 405
Number of extensions: 16
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 361
Length of database: 368
Length adjustment: 29
Effective length of query: 332
Effective length of database: 339
Effective search space:   112548
Effective search space used:   112548
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 49 (23.5 bits)

Align candidate SMc00710 SMc00710 (histidinol-phosphate aminotransferase)
to HMM TIGR01141 (hisC: histidinol-phosphate transaminase (EC 2.6.1.9))

Software error:

../bin/blast/fastacmd -i /tmp/list.3240.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.3240.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.