Align histidinol-phosphate aminotransferase [EC:2.6.1.9] (characterized)
to candidate SMc00710 SMc00710 histidinol-phosphate aminotransferase
Query= reanno::Phaeo:GFF2492 (361 letters) >FitnessBrowser__Smeli:SMc00710 Length = 368 Score = 356 bits (913), Expect = e-103 Identities = 186/358 (51%), Positives = 235/358 (65%), Gaps = 8/358 (2%) Query: 5 APQPGILDIALYEGGAAHVKGMSNVTKLSSNENPLGPSPKAIEAMQAAVSEMHRYPSSDH 64 AP+ GILDIA Y G H G++ V KLSSNE PLG SP+AIEA Q A + RYP Sbjct: 9 APRSGILDIAAYVPGKEHAPGVAKVHKLSSNETPLGASPRAIEAFQKAAFNLERYPDGQA 68 Query: 65 SGLRQAIGEVYGLPMEQIICGAGSDEIITFLCQAYAGPGDEVLFTEHGFAMYRISALAAG 124 + L++AI V+GL I+CG GSDE++ LC Y GPGDE + TEHGF +Y+I A+G Sbjct: 69 NALKEAIAAVHGLNPANILCGNGSDELLGLLCHTYLGPGDEGIVTEHGFLVYKIQITASG 128 Query: 125 ATPVEVAERDRVTDVDALLAGCTERTRLVFIANPNNPTGTMIGMADLARLADGLPKGALL 184 TPV V ER DVDA+LA TERT++VFIANP NPTGT I + ++ RL GLP G LL Sbjct: 129 GTPVTVKERQERVDVDAILAAVTERTKIVFIANPANPTGTYIPVEEVRRLHAGLPAGVLL 188 Query: 185 VLDGAYAEYV--EGYDAGAALVANRDNVVMTRTFSKIYGLGGARVGWGYAPKPIIDVLNR 242 VLD AYAEYV Y+AG LV++ NVVMTRTFSKIYGL G R+GW YAP+ +++ L+R Sbjct: 189 VLDAAYAEYVRRNDYEAGLELVSSNRNVVMTRTFSKIYGLAGLRIGWMYAPRDVVEALDR 248 Query: 243 VRGPFNLSSTALAGAEAAVRDTDYTEHCRKENAKWRTWLAEALAELGVPSDTSCANFILA 302 VRGPFNL++ A+A AA+RD + +N W + +AL ++G+ S NF+L Sbjct: 249 VRGPFNLNAAAIAAGAAAIRDQAFVAAAVDQNHTWLAKIGQALTDIGLRVTPSVTNFVLI 308 Query: 303 RFASPEEAGA----CDAFLQSRGLIVRRVTGYKLPAALRITVGDETACNALVAAMKVF 356 F PEEAG DA+L SRG I+R V Y P ALR+T+G E A +VAA+ F Sbjct: 309 HF--PEEAGMSASDADAYLTSRGFILRAVGAYGFPNALRMTIGSEEANKGVVAALTEF 364 Lambda K H 0.318 0.134 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 405 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 361 Length of database: 368 Length adjustment: 29 Effective length of query: 332 Effective length of database: 339 Effective search space: 112548 Effective search space used: 112548 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate SMc00710 SMc00710 (histidinol-phosphate aminotransferase)
to HMM TIGR01141 (hisC: histidinol-phosphate transaminase (EC 2.6.1.9))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01141.hmm # target sequence database: /tmp/gapView.31082.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01141 [M=349] Accession: TIGR01141 Description: hisC: histidinol-phosphate transaminase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.7e-91 290.2 0.0 1.1e-90 290.0 0.0 1.0 1 lcl|FitnessBrowser__Smeli:SMc00710 SMc00710 histidinol-phosphate am Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Smeli:SMc00710 SMc00710 histidinol-phosphate aminotransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 290.0 0.0 1.1e-90 1.1e-90 2 348 .. 12 363 .. 11 364 .. 0.96 Alignments for each domain: == domain 1 score: 290.0 bits; conditional E-value: 1.1e-90 TIGR01141 2 ekikklepYqpgarelgek.evvkLnsnEnPfgpsekvkealkeelkklhrYpdpqalelkealakylgveeeni 75 i ++++Y+pg+++ ++ +v kL+snE P+g s++++ea+++++ +l+rYpd qa +lkea+a++ g++++ni lcl|FitnessBrowser__Smeli:SMc00710 12 SGILDIAAYVPGKEHAPGVaKVHKLSSNETPLGASPRAIEAFQKAAFNLERYPDGQANALKEAIAAVHGLNPANI 86 678899******88777776899**********************99**************************** PP TIGR01141 76 llgnGsdelielliraflepgdavlvleptysmYevsakiagaevkevplkedgqedleavleaakekvklvfla 150 l gnGsdel+ ll++++l pgd+ +v+e+ + +Y++ ++ g ++v+ +++ + d++a+l+a++e++k+vf+a lcl|FitnessBrowser__Smeli:SMc00710 87 LCGNGSDELLGLLCHTYLGPGDEGIVTEHGFLVYKIQITASGGTPVTVKERQE-RVDVDAILAAVTERTKIVFIA 160 *************************************************9999.69******************* PP TIGR01141 151 sPnnPtGnllkreeiekvleev.edalVVvDeAYieFsee...asvlellaeypnlvvlrTlSKafgLAglRvGy 221 +P nPtG+++ ee++++ + + +l V+D AY e+ ++ + lel++ n+v++rT+SK++gLAglR+G lcl|FitnessBrowser__Smeli:SMc00710 161 NPANPTGTYIPVEEVRRLHAGLpAGVLLVLDAAYAEYVRRndyEAGLELVSSNRNVVMTRTFSKIYGLAGLRIGW 235 **********************88**************99888889***************************** PP TIGR01141 222 aianaeiiealekvrapynvsslaleaavaalrdsdkiektveevkkererlleelkkleglevyeSkaNFvlik 296 ++a +++eal++vr p+n++ a +a+ aa+rd++++++ v+++ + + ++l+++ gl+v +S +NFvli+ lcl|FitnessBrowser__Smeli:SMc00710 236 MYAPRDVVEALDRVRGPFNLNAAAIAAGAAAIRDQAFVAAAVDQNHTWLAKIGQALTDI-GLRVTPSVTNFVLIH 309 ***********************************************************.8************** PP TIGR01141 297 vke....daeelleallekgiivRdlksaeglleeclRitvGtreenerllealke 348 ++e a+++ l+ +g+i+R ++++ g+ +++lR+t+G++e n+ +++al e lcl|FitnessBrowser__Smeli:SMc00710 310 FPEeagmSASDADAYLTSRGFILRAVGAY-GF-PNALRMTIGSEEANKGVVAALTE 363 **98888788888899***********99.86.********************987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (349 nodes) Target sequences: 1 (368 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 9.31 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory