Align Branched-chain amino acid aminotransferase (EC 2.6.1.42) (characterized)
to candidate SMc02896 SMc02896 branched-chain amino acid aminotransferase
Query= reanno::Cup4G11:RR42_RS25890 (363 letters) >FitnessBrowser__Smeli:SMc02896 Length = 365 Score = 446 bits (1148), Expect = e-130 Identities = 215/356 (60%), Positives = 266/356 (74%), Gaps = 1/356 (0%) Query: 4 QTTFSLEPNPNALDAATRDALMRDPAFGRVFTDHMVTITWREGQGWQDAKVTARKPFSID 63 + TF E NP + + RDAL+ +P FGRVFTDHM TI + EG+GW DAK+ RK F +D Sbjct: 6 EQTFLFEQNPTRVANSERDALLANPGFGRVFTDHMATIRYSEGRGWHDAKIGPRKAFDLD 65 Query: 64 PACSVLHYGQEIFEGMKAYRGADGAVTLFRPLENARRFQASAKRMAMPALPESLFLEAIE 123 P+ VLHY QEIFEGMKAYR DG TLFRP NARRF+ SA R+AM LPE LF++++ Sbjct: 66 PSTLVLHYAQEIFEGMKAYRLPDGGATLFRPDANARRFRNSALRLAMAPLPEELFVQSVR 125 Query: 124 QLVRIDQAWVPHGSGS-LYLRPFMFANEVFLGIKPASEFIFCVIACPVGPYFKGGDKAVS 182 +LVRID+ W+P G G+ LYLRPFM A EV LG+KP++E+++CVIA VG YFKGG A++ Sbjct: 126 ELVRIDRDWIPAGEGAALYLRPFMIATEVLLGVKPSAEYLYCVIASSVGSYFKGGAPAIT 185 Query: 183 VWVSENYTRAAPGGTGEAKCGGNYAGSLVAQNEATANGCDQVVFLDAAEHRWVEELGGMN 242 +WVSENYTRAAPGGTGEAKCGGNYA SL AQ EA GC+QVVFLDA E R+VEELGGMN Sbjct: 186 IWVSENYTRAAPGGTGEAKCGGNYAASLAAQAEAMQEGCEQVVFLDAVERRFVEELGGMN 245 Query: 243 IFFVMDDGTLVTPPLSGSILPGITRASVIELAREMGMVVEERRYSYPEWEADAKSGRLAE 302 +FF DG+L TPPL+G+ILPGITR S+I LAR+MG+ V E Y+ +W+ADA+SGRL E Sbjct: 246 VFFGFRDGSLQTPPLTGTILPGITRDSLITLARDMGLTVREEPYAIDQWQADAESGRLTE 305 Query: 303 AFVCGTAATLVAIGEVRSARTRFAIGNGTAGNTVKVLRDRLVEIQRNQAAGPAGWV 358 AF CGTAA + IG+V+ F IG+G AG L+ L++IQ +A P GW+ Sbjct: 306 AFACGTAAVVTPIGKVKGREHSFTIGDGGAGPVASRLKSALLDIQNGRAPDPHGWL 361 Lambda K H 0.321 0.135 0.415 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 452 Number of extensions: 18 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 363 Length of database: 365 Length adjustment: 29 Effective length of query: 334 Effective length of database: 336 Effective search space: 112224 Effective search space used: 112224 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
Align candidate SMc02896 SMc02896 (branched-chain amino acid aminotransferase)
to HMM TIGR01123 (ilvE: branched-chain amino acid aminotransferase (EC 2.6.1.42))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01123.hmm # target sequence database: /tmp/gapView.26721.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01123 [M=313] Accession: TIGR01123 Description: ilvE_II: branched-chain amino acid aminotransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-125 404.7 0.0 1.3e-125 404.5 0.0 1.0 1 lcl|FitnessBrowser__Smeli:SMc02896 SMc02896 branched-chain amino ac Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Smeli:SMc02896 SMc02896 branched-chain amino acid aminotransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 404.5 0.0 1.3e-125 1.3e-125 1 311 [. 51 362 .. 51 364 .. 0.99 Alignments for each domain: == domain 1 score: 404.5 bits; conditional E-value: 1.3e-125 TIGR01123 1 WdeaelaseaeleldegsavlhYgqevfeGlkayRtadGkillfRpdanakRlrrsaerlllPeleeelflealk 75 W++a++ + +++ ld+++ vlhY+qe+feG+kayR dG ++lfRpdana+R+r+sa rl++ l+eelf+++++ lcl|FitnessBrowser__Smeli:SMc02896 51 WHDAKIGPRKAFDLDPSTLVLHYAQEIFEGMKAYRLPDGGATLFRPDANARRFRNSALRLAMAPLPEELFVQSVR 125 *************************************************************************** PP TIGR01123 76 qlvkadkdwvpkakseasLYlRPfliatednlGvkaakeylflvlasPvGaYfkgglapvsifveteyvRaapkG 150 +lv++d+dw+p a+ +a+LYlRPf+iate lGvk++ eyl++v+as vG+Yfkgg ++i+v+++y+Raap+G lcl|FitnessBrowser__Smeli:SMc02896 126 ELVRIDRDWIP-AGEGAALYLRPFMIATEVLLGVKPSAEYLYCVIASSVGSYFKGGAPAITIWVSENYTRAAPGG 199 ***********.555************************************************************ PP TIGR01123 151 tGavkvgGnYaasllaqkkaaeqglddvvyldpvekkkieevGaaniflitkdgelvttplsesiLegvtresll 225 tG +k+gGnYaasl aq++a ++g+++vv+ld+ve++ +ee+G++n+f+ +dg+l t+pl++ iL+g+tr+sl+ lcl|FitnessBrowser__Smeli:SMc02896 200 TGEAKCGGNYAASLAAQAEAMQEGCEQVVFLDAVERRFVEELGGMNVFFGFRDGSLQTPPLTGTILPGITRDSLI 274 *************************************************************************** PP TIGR01123 226 elakdlgleveereiaidelkaaveaGei..vfacGtaavitPvgelkiegkevevkseevGevtkklrdeltdi 298 +la+d+gl+v+e+ aid+++a +e+G + +facGtaav+tP+g++k ++++++ ++ G+v+ +l+ +l+di lcl|FitnessBrowser__Smeli:SMc02896 275 TLARDMGLTVREEPYAIDQWQADAESGRLteAFACGTAAVVTPIGKVKGREHSFTIGDGGAGPVASRLKSALLDI 349 ***************************9999******************************************** PP TIGR01123 299 qyGkledkegWiv 311 q G++ d++gW+ lcl|FitnessBrowser__Smeli:SMc02896 350 QNGRAPDPHGWLD 362 ***********86 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (313 nodes) Target sequences: 1 (365 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 7.07 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory