Align Cystathionine gamma-synthase; CGS; O-succinylhomoserine (thiol)-lyase; EC 2.5.1.48 (characterized)
to candidate SMc02595 SMc02595 cystathionine gamma-synthase
Query= SwissProt::P00935 (386 letters) >lcl|FitnessBrowser__Smeli:SMc02595 SMc02595 cystathionine gamma-synthase Length = 408 Score = 395 bits (1014), Expect = e-114 Identities = 202/376 (53%), Positives = 260/376 (69%), Gaps = 1/376 (0%) Query: 7 TIAVRSGLNDDEQYGCVVPPIHLSSTYNFTGFNEPRAHDYSRRGNPTRDVVQRALAELEG 66 T A G+ D +G VVPP++LSSTY F GF+ PRA+DY R GNPTRD++ +ALA+LEG Sbjct: 33 TTAAAHGVATDPAFGSVVPPLYLSSTYEFAGFDTPRAYDYGRSGNPTRDLLAQALAKLEG 92 Query: 67 GAGAVLTNTGMSAIHLVTTVFLKPGDLLVAPHDCYGGSYRLFDSLAKRGCYRVLFVDQGD 126 GA AV+T +GM+A+ L+ L+ L++APHDCYGG+ RL + A G DQ D Sbjct: 93 GADAVVTPSGMAALDLLLGR-LRRNHLVLAPHDCYGGTLRLLKARADLGHLTFRLTDQRD 151 Query: 127 EQALRAALAEKPKLVLVESPSNPLLRVVDIAKICHLAREVGAVSVVDNTFLSPALQNPLA 186 AAL++ P LVL+ESPSNPL+RV DIA++ LA+ G+ VDNTFLSPALQ PL+ Sbjct: 152 FGGFEAALSDAPALVLIESPSNPLMRVTDIARLSTLAKAAGSAVAVDNTFLSPALQQPLS 211 Query: 187 LGADLVLHSCTKYLNGHSDVVAGVVIAKDPDVVTELAWWANNIGVTGGAFDSYLLLRGLR 246 LGAD +HS TK+LNGHSDV+AG VIA +P +L WAN G FD++L LRGLR Sbjct: 212 LGADYAIHSATKFLNGHSDVIAGAVIAAEPQEAHDLKRWANVTGAVAAPFDAWLTLRGLR 271 Query: 247 TLVPRMELAQRNAQAIVKYLQTQPLVKKLYHPSLPENQGHEIAARQQKGFGAMLSFELDG 306 TL RM +R+A I +YL P V+ +++ LP++ HE+A RQQ+GFGAM+SFEL+G Sbjct: 272 TLFARMSSQERSAMTIAEYLDAHPAVRHVHYAGLPDHADHEVARRQQRGFGAMMSFELEG 331 Query: 307 DEQTLRRFLGGLSLFTLAESLGGVESLISHAATMTHAGMAPEARAAAGISETLLRISTGI 366 +RRFL + FTLAESLGGVESL++H ATMTH M PEAR AGI + LLR+S G+ Sbjct: 332 GVPAVRRFLAHIRCFTLAESLGGVESLVAHPATMTHLDMGPEARERAGIRDELLRLSIGL 391 Query: 367 EDGEDLIADLENGFRA 382 E +DL+ LE G A Sbjct: 392 EHIDDLMEGLELGLGA 407 Lambda K H 0.319 0.136 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 452 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 386 Length of database: 408 Length adjustment: 31 Effective length of query: 355 Effective length of database: 377 Effective search space: 133835 Effective search space used: 133835 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate SMc02595 SMc02595 (cystathionine gamma-synthase)
to HMM TIGR02080 (metB: O-succinylhomoserine (thiol)-lyase (EC 2.5.1.48))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR02080.hmm # target sequence database: /tmp/gapView.12113.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR02080 [M=382] Accession: TIGR02080 Description: O_succ_thio_ly: O-succinylhomoserine (thiol)-lyase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-200 652.1 0.0 1.3e-200 651.9 0.0 1.0 1 lcl|FitnessBrowser__Smeli:SMc02595 SMc02595 cystathionine gamma-syn Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Smeli:SMc02595 SMc02595 cystathionine gamma-synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 651.9 0.0 1.3e-200 1.3e-200 2 382 .] 29 408 .] 28 408 .] 0.99 Alignments for each domain: == domain 1 score: 651.9 bits; conditional E-value: 1.3e-200 TIGR02080 2 rkkatiavrsGlesdkqygavvpPiylsttyefagfnepraydysrsgnPtrdllekalaelekGadavvtssGm 76 ++++t+a+++G+++d+++g+vvpP+yls+tyefagf++praydy+rsgnPtrdll++ala+le+Gadavvt+sGm lcl|FitnessBrowser__Smeli:SMc02595 29 DRAETTAAAHGVATDPAFGSVVPPLYLSSTYEFAGFDTPRAYDYGRSGNPTRDLLAQALAKLEGGADAVVTPSGM 103 7899*********************************************************************** PP TIGR02080 77 saiellviallkpddllvaPhdcyGGtyrllkalakkgklkvqlvdqsdeealekalaekpklvlietPsnPllr 151 +a++ll+ ++l++++l++aPhdcyGGt+rllka+a+ g+l+++l+dq+d+ ++e+al+++p+lvlie+PsnPl+r lcl|FitnessBrowser__Smeli:SMc02595 104 AALDLLL-GRLRRNHLVLAPHDCYGGTLRLLKARADLGHLTFRLTDQRDFGGFEAALSDAPALVLIESPSNPLMR 177 ******9.******************************************************************* PP TIGR02080 152 vvdiaklcklakaagavvvvdntflsPilqkPlalGadlvlhsatkylnGhsdviaGaviakdkqlaeelawwan 226 v+dia+l++lakaag++v+vdntflsP+lq+Pl+lGad+++hsatk+lnGhsdviaGavia+++q+a++l++wan lcl|FitnessBrowser__Smeli:SMc02595 178 VTDIARLSTLAKAAGSAVAVDNTFLSPALQQPLSLGADYAIHSATKFLNGHSDVIAGAVIAAEPQEAHDLKRWAN 252 *************************************************************************** PP TIGR02080 227 alGvtgaafdsylllrGlrtlaarvreqernakkiveylqkqplvkkvyypglpdhagheiaakqqkGfGallsf 301 ++G+++a+fd++l+lrGlrtl+ar+++qer+a++i+eyl+++p+v++v+y+glpdha+he+a++qq+GfGa++sf lcl|FitnessBrowser__Smeli:SMc02595 253 VTGAVAAPFDAWLTLRGLRTLFARMSSQERSAMTIAEYLDAHPAVRHVHYAGLPDHADHEVARRQQRGFGAMMSF 327 *************************************************************************** PP TIGR02080 302 elkGgeeevkkflkklklftlaeslGGvesliahpatmthaamekeareeaGikdellrlsvGledaddliadle 376 el+Gg+++v++fl+++++ftlaeslGGvesl+ahpatmth +m++eare+aGi+dellrls+Gle++ddl+++le lcl|FitnessBrowser__Smeli:SMc02595 328 ELEGGVPAVRRFLAHIRCFTLAESLGGVESLVAHPATMTHLDMGPEARERAGIRDELLRLSIGLEHIDDLMEGLE 402 *************************************************************************** PP TIGR02080 377 qalaav 382 +l a+ lcl|FitnessBrowser__Smeli:SMc02595 403 LGLGAC 408 **9876 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (382 nodes) Target sequences: 1 (408 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 10.96 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory