Align Methionine synthase (cobalamin-dependent) (EC 2.1.1.13) (characterized)
to candidate SMc04325 SMc04325 methionine synthase I
Query= reanno::DvH:207036 (804 letters) >FitnessBrowser__Smeli:SMc04325 Length = 337 Score = 176 bits (447), Expect = 1e-48 Identities = 115/283 (40%), Positives = 159/283 (56%), Gaps = 14/283 (4%) Query: 14 LLFDGGLGTMLQARGLPAGVSPEQFCLDRPDVLRGIHADYVRAGADILTTNTFGGSR--F 71 LL DG GT L A GL AG +PE + +PD + +H D+V AGADI+ TN+FGG+R Sbjct: 18 LLADGATGTSLFAMGLEAGEAPEIWNETKPDNITKLHQDFVDAGADIILTNSFGGTRHRL 77 Query: 72 KLGDGFDVV-DFNRRMAAIAREAADASGRQAFVAGSIGPTGHFVKPLGEVEPAALVAAFR 130 KL D V N+R A IAR AD + R+ AGS+GPTG + PLG + VAAF Sbjct: 78 KLHQAEDRVHQLNKRAAEIARAVADKAPRKVITAGSVGPTGELLIPLGALSYEDAVAAFV 137 Query: 131 EQVRGLVAGGADLLMIETQFDLAEARAAVVAARAECSLPIAVSMTFEN-GVSLTGSTPEV 189 EQ+ GL AGGA++ IET E RAA AA A+ LP + +F+ G ++ G P+ Sbjct: 138 EQIEGLKAGGAEVAWIETMSSPDEIRAAAEAA-AKVGLPYVYTGSFDTAGKTMMGLHPKD 196 Query: 190 F--VATMLNLGVDLLGTNCSAGPDQMHDVVASLL----ASASVPVLVEPNAGLPELIDGK 243 VA + G +G NC G D+++SLL AS ++V+ N G+PE + Sbjct: 197 IHGVAADIGEGPVAVGANCGVGAS---DILSSLLDMTAASPEATIVVKGNCGIPEFRGSE 253 Query: 244 TVFRLPPAPFAEKTAAFAAMGARVLGGCCGTTPDHIAALRQAV 286 + P AE GA+++GGCCGT+ +H+AA+R A+ Sbjct: 254 IHYSGTPPLMAEYARLAVDAGAKIIGGCCGTSCNHLAAMRLAI 296 Lambda K H 0.320 0.137 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 659 Number of extensions: 26 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 804 Length of database: 337 Length adjustment: 35 Effective length of query: 769 Effective length of database: 302 Effective search space: 232238 Effective search space used: 232238 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
Align Methionine synthase (cobalamin-dependent) (EC 2.1.1.13) (characterized)
to candidate SMc04342 SMc04342 methyltetrahydrofolate:corrinoid/iron-sulfur protein methyltransferase
Query= reanno::DvH:207036 (804 letters) >FitnessBrowser__Smeli:SMc04342 Length = 320 Score = 171 bits (432), Expect = 7e-47 Identities = 109/292 (37%), Positives = 158/292 (54%), Gaps = 5/292 (1%) Query: 302 VLTTRSHLVRVGGDAPVRIIGERINPTGKKQLIAELQAGDFSLALRFSDEQVEAGAPILD 361 ++ + + + +G D P +IGERINPTG+K+L AE+ G+F ++ + EQV AGA +LD Sbjct: 5 IVASATREIIIGFDQPFCVIGERINPTGRKKLAAEMIEGNFDTVIKDALEQVAAGATMLD 64 Query: 362 VNVGAPMVD-EEVLLPDLVQRLITRHG---VPLSIDSSNAAAIERALPYCPGSTLVNSIS 417 VN G VD E P LV+ L G VPLSIDSS AAIE L G LVNS++ Sbjct: 65 VNAGVTAVDPNETEPPLLVKTLEIVQGLVDVPLSIDSSVTAAIEAGLRVAKGRPLVNSVT 124 Query: 418 GEPGRMERLGPLCRDHGAPFILLPLKGRKLPVAATERIAIIEELLVQAEGLGIPRRLVMV 477 GE ++E + PLC+ + P + + + + R A+ ++++ +A GI ++V Sbjct: 125 GEEEKLEAILPLCKKYDVPVVAISNDETGISMDPDVRFAVAKKIVERAADYGIKPHDIVV 184 Query: 478 DVLALAVSSKAEAARQCLETIRWCTAN-GFATTIGLSNISFGLPARELLNGTFLAMAAGA 536 D L + + + A +Q +R TT GLSNISFGLP R +N F+ M GA Sbjct: 185 DPLVMPIGALGSAGQQVFALLRRLREELKVNTTCGLSNISFGLPHRHGINAGFIPMVIGA 244 Query: 537 GLSSCIAHPGNGRIRETVACADVLLARDANAERFIDAYAAWTPATQGGPVAS 588 G++S I +P + E V A+VL D N +I Y PA G VA+ Sbjct: 245 GMTSAIMNPCRPQEMEAVRAANVLNGTDPNCTNWIMTYRDHKPAEGGHAVAA 296 Lambda K H 0.320 0.137 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 617 Number of extensions: 43 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 804 Length of database: 320 Length adjustment: 34 Effective length of query: 770 Effective length of database: 286 Effective search space: 220220 Effective search space used: 220220 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory