GapMind for Amino acid biosynthesis

 

Alignments for a candidate for cmutase in Sinorhizobium meliloti 1021

Align isochorismate lyase (EC 4.2.99.21) (characterized)
to candidate SMc02253 SMc02253 salicylate biosynthesis protein

Query= BRENDA::Q51507
         (101 letters)



>FitnessBrowser__Smeli:SMc02253
          Length = 101

 Score = 55.8 bits (133), Expect = 1e-13
 Identities = 36/94 (38%), Positives = 50/94 (53%), Gaps = 5/94 (5%)

Query: 2  KTPEDCTGLADIREAIDRIDLDIVQALGRRMDYVKAASRFKAS---EAAIPAPERVAAML 58
          KTP +CT +ADIR  IDR+D  ++     R  Y++ A+  K     +A IPA  RVA + 
Sbjct: 3  KTPAECTTMADIRVEIDRLDRALMTLFAERWGYIERAAEIKRPLNLKADIPA--RVAEVK 60

Query: 59 PERARWAEENGLDAPFVEGLFAQIIHWYIAEQIK 92
              R A E GLD  F E  + Q++   IA + K
Sbjct: 61 ENARRNAVELGLDPDFYERFWGQLVERAIAHERK 94


Lambda     K      H
   0.322    0.135    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 41
Number of extensions: 6
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 101
Length of database: 101
Length adjustment: 11
Effective length of query: 90
Effective length of database: 90
Effective search space:     8100
Effective search space used:     8100
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.0 bits)
S2: 39 (19.6 bits)

Align candidate SMc02253 SMc02253 (salicylate biosynthesis protein)
to HMM PF01817 (CM_2)

Software error:

../bin/blast/fastacmd -i /tmp/list.14149.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.14149.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.