Align isochorismate lyase (EC 4.2.99.21) (characterized)
to candidate SMc02253 SMc02253 salicylate biosynthesis protein
Query= BRENDA::Q51507 (101 letters) >FitnessBrowser__Smeli:SMc02253 Length = 101 Score = 55.8 bits (133), Expect = 1e-13 Identities = 36/94 (38%), Positives = 50/94 (53%), Gaps = 5/94 (5%) Query: 2 KTPEDCTGLADIREAIDRIDLDIVQALGRRMDYVKAASRFKAS---EAAIPAPERVAAML 58 KTP +CT +ADIR IDR+D ++ R Y++ A+ K +A IPA RVA + Sbjct: 3 KTPAECTTMADIRVEIDRLDRALMTLFAERWGYIERAAEIKRPLNLKADIPA--RVAEVK 60 Query: 59 PERARWAEENGLDAPFVEGLFAQIIHWYIAEQIK 92 R A E GLD F E + Q++ IA + K Sbjct: 61 ENARRNAVELGLDPDFYERFWGQLVERAIAHERK 94 Lambda K H 0.322 0.135 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 41 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 101 Length of database: 101 Length adjustment: 11 Effective length of query: 90 Effective length of database: 90 Effective search space: 8100 Effective search space used: 8100 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.0 bits) S2: 39 (19.6 bits)
Align candidate SMc02253 SMc02253 (salicylate biosynthesis protein)
to HMM PF01817 (CM_2)
../bin/blast/fastacmd -i /tmp/list.12005.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.12005.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.
For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.