Align acetylornithine/N-succinyldiaminopimelate aminotransferase [EC:2.6.1.11 2.6.1.17] (characterized)
to candidate SMc02138 SMc02138 acetylornithine transaminase
Query= reanno::azobra:AZOBR_RS19025 (389 letters) >FitnessBrowser__Smeli:SMc02138 Length = 399 Score = 487 bits (1253), Expect = e-142 Identities = 245/379 (64%), Positives = 290/379 (76%) Query: 8 TYARADIVFERGEGPYLYATDGRRFLDFAAGVAVNVLGHANPYLVEALTAQAHKLWHTSN 67 TY RA + FERGEG +L A DG R+LDFAAGVAVN LGHA+P+LVEAL AQA K+WH SN Sbjct: 10 TYLRAPLRFERGEGVWLIAEDGTRYLDFAAGVAVNSLGHAHPHLVEALKAQADKVWHLSN 69 Query: 68 LFRVAGQESLAKRLTEATFADTVFFTNSGAEAWECGAKLIRKYHYEKGDKARTRIITFEQ 127 L+ +AGQESLA+RLT+ TFAD VFFTNSGAEA EC K R+YH+ KG + +ITFE Sbjct: 70 LYEIAGQESLARRLTQVTFADRVFFTNSGAEALECAIKTARRYHFAKGHVEKFHVITFEG 129 Query: 128 AFHGRTLAAVSAAQQEKLIKGFGPLLDGFDLVPFGDLEAVRNAVTDETAGICLEPIQGEG 187 AFHGRTLA ++A Q+K I+GFGP GF VPFGD+ AV+NA+ +ETA I +EPIQGEG Sbjct: 130 AFHGRTLATIAAGGQQKYIEGFGPKAPGFYQVPFGDIGAVKNAINEETAAILVEPIQGEG 189 Query: 188 GIRAGSVEFLRGLREICDEHGLLLFLDEIQCGMGRTGKLFAHEWAGITPDVMAVAKGIGG 247 GIR S EF++GLRE+CDE GLLL LDE+Q G+GRTGKLFAHEWAGI PD+MAVAKGIGG Sbjct: 190 GIRTASKEFMQGLRELCDEFGLLLILDEVQSGVGRTGKLFAHEWAGIKPDIMAVAKGIGG 249 Query: 248 GFPLGACLATEKAASGMTAGTHGSTYGGNPLATAVGNAVLDKVLEPGFLDHVQRIGGLLQ 307 GFPLGACLATE AA+GM AGTHGSTYGGNPLA AVGNAVLD VL GFLD V+ + + + Sbjct: 250 GFPLGACLATEAAAAGMVAGTHGSTYGGNPLAMAVGNAVLDVVLAEGFLDQVREVALVFR 309 Query: 308 DRLAGLVAENPAVFKGVRGKGLMLGLACGPAVGDVVVALRANGLLSVPAGDNVVRLLPPL 367 LA L P V + +RG GLMLG+ D++ A+RA LL VPAG+NV+RLLPPL Sbjct: 310 QGLASLKDRFPDVIEEIRGDGLMLGIKAKVPSADLLKAIRAEKLLVVPAGENVLRLLPPL 369 Query: 368 NIGEAEVEEAVAILAKTAK 386 AE E +A L + A+ Sbjct: 370 ITTPAEAREGLARLERAAE 388 Lambda K H 0.321 0.139 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 514 Number of extensions: 16 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 389 Length of database: 399 Length adjustment: 31 Effective length of query: 358 Effective length of database: 368 Effective search space: 131744 Effective search space used: 131744 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory