Align Glutamate 5-kinase 2; EC 2.7.2.11; Gamma-glutamyl kinase 2; GK 2 (uncharacterized)
to candidate SMc03252 SMc03252 gamma-glutamyl kinase
Query= curated2:Q92LF7 (269 letters) >FitnessBrowser__Smeli:SMc03252 Length = 282 Score = 518 bits (1335), Expect = e-152 Identities = 269/269 (100%), Positives = 269/269 (100%) Query: 1 MEDKFDLSSARLVVVKIGSTLVLDRETSGIRSSWLESLTEDVSRLLTRGQQVVLVSSGAV 60 MEDKFDLSSARLVVVKIGSTLVLDRETSGIRSSWLESLTEDVSRLLTRGQQVVLVSSGAV Sbjct: 14 MEDKFDLSSARLVVVKIGSTLVLDRETSGIRSSWLESLTEDVSRLLTRGQQVVLVSSGAV 73 Query: 61 AIGSTIVDRLATYSQVSHKQAAAALGQVQLTHAYSESLKRHGLQVAQLLMGRGDLVDPAH 120 AIGSTIVDRLATYSQVSHKQAAAALGQVQLTHAYSESLKRHGLQVAQLLMGRGDLVDPAH Sbjct: 74 AIGSTIVDRLATYSQVSHKQAAAALGQVQLTHAYSESLKRHGLQVAQLLMGRGDLVDPAH 133 Query: 121 RLNTRAVLLRLIDLGAVPLVNENDTTATCGTRVGDNDRLAAWIAEIINADLLILLSNVDG 180 RLNTRAVLLRLIDLGAVPLVNENDTTATCGTRVGDNDRLAAWIAEIINADLLILLSNVDG Sbjct: 134 RLNTRAVLLRLIDLGAVPLVNENDTTATCGTRVGDNDRLAAWIAEIINADLLILLSNVDG 193 Query: 181 LFMKDPRNNPLTPMLTEVESITREIEAMATQSVDPYSSGGMISKIEAGKIAMNAGCRMII 240 LFMKDPRNNPLTPMLTEVESITREIEAMATQSVDPYSSGGMISKIEAGKIAMNAGCRMII Sbjct: 194 LFMKDPRNNPLTPMLTEVESITREIEAMATQSVDPYSSGGMISKIEAGKIAMNAGCRMII 253 Query: 241 ANGTRSHPLYAIESGGPSTHFIPVARDRV 269 ANGTRSHPLYAIESGGPSTHFIPVARDRV Sbjct: 254 ANGTRSHPLYAIESGGPSTHFIPVARDRV 282 Lambda K H 0.318 0.132 0.368 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 416 Number of extensions: 3 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 269 Length of database: 282 Length adjustment: 25 Effective length of query: 244 Effective length of database: 257 Effective search space: 62708 Effective search space used: 62708 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
Align candidate SMc03252 SMc03252 (gamma-glutamyl kinase)
to HMM TIGR01027 (proB: glutamate 5-kinase (EC 2.7.2.11))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01027.hmm # target sequence database: /tmp/gapView.4037.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01027 [M=363] Accession: TIGR01027 Description: proB: glutamate 5-kinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4e-73 232.6 0.3 4.7e-73 232.3 0.3 1.0 1 lcl|FitnessBrowser__Smeli:SMc03252 SMc03252 gamma-glutamyl kinase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Smeli:SMc03252 SMc03252 gamma-glutamyl kinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 232.3 0.3 4.7e-73 4.7e-73 3 242 .. 26 266 .. 24 281 .. 0.95 Alignments for each domain: == domain 1 score: 232.3 bits; conditional E-value: 4.7e-73 TIGR01027 3 iVvKlGsssLteesgk.lkrsklaelveqvaklkkaGhevvivsSGavaaGleaLglperpkklaekQalaaVGQ 76 +VvK+Gs+++ + +++ +++s l++l+e+v++l + G++vv+vsSGava G + + ++++kQa+aa GQ lcl|FitnessBrowser__Smeli:SMc03252 26 VVVKIGSTLVLDRETSgIRSSWLESLTEDVSRLLTRGQQVVLVSSGAVAIGSTIVDRLATYSQVSHKQAAAALGQ 100 8*******999888888********************************************************** PP TIGR01027 77 grLmklyeklfsqyglkvaQiLLtradlskrerylNarntleellelgvvpivNENDtvaveeikfGDNDtLsal 151 ++L ++y+++++++gl+vaQ+L+ r dl + + lN r+ l +l++lg+vp+vNENDt+a+ ++GDND+L+a lcl|FitnessBrowser__Smeli:SMc03252 101 VQLTHAYSESLKRHGLQVAQLLMGRGDLVDPAHRLNTRAVLLRLIDLGAVPLVNENDTTATCGTRVGDNDRLAAW 175 *************************************************************************** PP TIGR01027 152 vaalveAdlLvlltdvdgLydadprtnpdAklieeveeieeelkavagssgssvGTGGmrtKleaaelAsragve 226 +a +++AdlL+ll++vdgL+ +dpr+np ++ eve+i++e++a+a++s + GGm +K+ea ++A++ag + lcl|FitnessBrowser__Smeli:SMc03252 176 IAEIINADLLILLSNVDGLFMKDPRNNPLTPMLTEVESITREIEAMATQSVDPYSSGGMISKIEAGKIAMNAGCR 250 *************************************************************************** PP TIGR01027 227 viiasgekpekiadll 242 +iia+g++ + + ++ lcl|FitnessBrowser__Smeli:SMc03252 251 MIIANGTRSHPLYAIE 266 *******977766554 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (363 nodes) Target sequences: 1 (282 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 8.35 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory