Align glutamate 5-kinase (EC 2.7.2.11) (characterized)
to candidate SMc03776 SMc03776 gamma-glutamyl kinase
Query= reanno::Korea:Ga0059261_3512 (367 letters) >FitnessBrowser__Smeli:SMc03776 Length = 393 Score = 322 bits (824), Expect = 1e-92 Identities = 184/362 (50%), Positives = 242/362 (66%), Gaps = 8/362 (2%) Query: 11 RLVVKIGSALLVDPEGAIRRDWLEGIAADIAARVRAGQQIAVVSSGAIALGARRLKLAKG 70 R+V+KIGSALLVD +++ WL+ + ADIAA G ++ VVSSGAIALG L L G Sbjct: 13 RVVIKIGSALLVDRRTGLKKSWLDALCADIAALRAKGVEVLVVSSGAIALGRTVLDLPAG 72 Query: 71 GRASLEDAQAAAATGQIALSQVWAEVLAANGLTAAQMLVTLDDLEDRRRYLNAAATLGRL 130 LE++QAAAA GQI L++ W+E L+ + + A Q+L+TL D E+RRRYLNA AT+G+L Sbjct: 73 A-LKLEESQAAAAVGQIVLARAWSESLSTHAIVAGQILLTLGDTEERRRYLNARATIGQL 131 Query: 131 LSLGVVPVINENDSVATAEIRFGDNDRLAARVAQAADASGVVLLSDIDGLYDRNPAL-PG 189 L LG VP+INEND+VAT EIR+GDNDRLAARVA A +VLLSDIDGLY P L P Sbjct: 132 LKLGSVPIINENDTVATTEIRYGDNDRLAARVATMVGADLLVLLSDIDGLYTAPPHLDPN 191 Query: 190 AVHIPVVERIDGRVEGMADRGSASGMGSGGMVSKIEAARIAASAGVSLAIANGRVDRPLS 249 A + V I +E MA G+AS + GGM +KI+A +IA +AG ++ IA+G+ D PL+ Sbjct: 192 ARFLETVAEITPEIEAMAG-GAASELSRGGMRTKIDAGKIATTAGCAMIIASGKPDHPLA 250 Query: 250 ---ADARHTVFLPE-KRTRARKAWLAGRLTAKGSIIVDAGAAQALTEGRSLLAIGATAIR 305 A AR + F P ARK W+AG+L GS+ +DAGA AL G+SLL G + Sbjct: 251 AIEAGARSSWFAPSGSPVTARKTWIAGQLLPAGSLSIDAGAETALRSGKSLLPAGVRQVT 310 Query: 306 GMFFRGDLVTIEGPNG-PIARGLSEYDAPDAQAILGTRSDDQGEILGYAPRSTLVHRNHM 364 G F RGD + I G +G IARGL+ YDA +A+ I G +S + ILGYA R+ +VHR+ + Sbjct: 311 GSFSRGDTIAIIGASGREIARGLAGYDADEARQIAGKKSAEIAAILGYAGRTAMVHRDDL 370 Query: 365 AL 366 + Sbjct: 371 VM 372 Lambda K H 0.319 0.134 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 409 Number of extensions: 21 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 367 Length of database: 393 Length adjustment: 30 Effective length of query: 337 Effective length of database: 363 Effective search space: 122331 Effective search space used: 122331 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
Align candidate SMc03776 SMc03776 (gamma-glutamyl kinase)
to HMM TIGR01027 (proB: glutamate 5-kinase (EC 2.7.2.11))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01027.hmm # target sequence database: /tmp/gapView.10495.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01027 [M=363] Accession: TIGR01027 Description: proB: glutamate 5-kinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-122 394.4 0.3 2.9e-122 394.2 0.3 1.0 1 lcl|FitnessBrowser__Smeli:SMc03776 SMc03776 gamma-glutamyl kinase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Smeli:SMc03776 SMc03776 gamma-glutamyl kinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 394.2 0.3 2.9e-122 2.9e-122 1 362 [. 12 371 .. 12 372 .. 0.99 Alignments for each domain: == domain 1 score: 394.2 bits; conditional E-value: 2.9e-122 TIGR01027 1 kriVvKlGsssLteesgklkrsklaelveqvaklkkaGhevvivsSGavaaGleaLglperpkklaekQalaaVG 75 +r+V+K+Gs++L++ + lk+s l +l++++a+l+++G ev++vsSGa+a G + L+lp kl+e Qa+aaVG lcl|FitnessBrowser__Smeli:SMc03776 12 RRVVIKIGSALLVDRRTGLKKSWLDALCADIAALRAKGVEVLVVSSGAIALGRTVLDLPAGALKLEESQAAAAVG 86 59************************************************************************* PP TIGR01027 76 QgrLmklyeklfsqyglkvaQiLLtradlskrerylNarntleellelgvvpivNENDtvaveeikfGDNDtLsa 150 Q L +++++++s++ + +QiLLt d ++r+rylNar+t+ +ll+lg vpi+NENDtva++ei+ GDND+L+a lcl|FitnessBrowser__Smeli:SMc03776 87 QIVLARAWSESLSTHAIVAGQILLTLGDTEERRRYLNARATIGQLLKLGSVPIINENDTVATTEIRYGDNDRLAA 161 *************************************************************************** PP TIGR01027 151 lvaalveAdlLvlltdvdgLydadprtnpdAklieeveeieeelkavagssgssvGTGGmrtKleaaelAsragv 225 va++v+AdlLvll+d+dgLy+a p+ +p+A+++e+v ei+ e++a+ag+++s++ GGmrtK+ a ++A++ag lcl|FitnessBrowser__Smeli:SMc03776 162 RVATMVGADLLVLLSDIDGLYTAPPHLDPNARFLETVAEITPEIEAMAGGAASELSRGGMRTKIDAGKIATTAGC 236 *************************************************************************** PP TIGR01027 226 eviiasgekpekiadlledaavgtlfeakkkklknrkqwilaaseakGkiivdegaeeallekgksLlpagvvev 300 +iiasg+ p++ ++++e a + f+++ + + +rk+wi+ ++ ++G++ +d+gae+al++ gksLlpagv +v lcl|FitnessBrowser__Smeli:SMc03776 237 AMIIASGK-PDHPLAAIEAGARSSWFAPSGSPVTARKTWIAGQLLPAGSLSIDAGAETALRS-GKSLLPAGVRQV 309 *****998.67777788888999**************************************9.************ PP TIGR01027 301 egnFsrgevveilaeegqeigkglvnysseelekikglkseeiedvLgyekkeevvhrdnlv 362 +g+Fsrg+++ i +g+ei++gl+ y+++e ++i+g+ks+ei+++Lgy ++ vhrd+lv lcl|FitnessBrowser__Smeli:SMc03776 310 TGSFSRGDTIAIIGASGREIARGLAGYDADEARQIAGKKSAEIAAILGYAGRTAMVHRDDLV 371 ************************************************************98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (363 nodes) Target sequences: 1 (393 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.00s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.84 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory